KEGG   Xanthomonas perforans: BJD13_09855Help
Entry
BJD13_09855       CDS       T04778                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00071  Fatty acid degradation
xpe00072  Synthesis and degradation of ketone bodies
xpe00280  Valine, leucine and isoleucine degradation
xpe00310  Lysine degradation
xpe00362  Benzoate degradation
xpe00380  Tryptophan metabolism
xpe00620  Pyruvate metabolism
xpe00630  Glyoxylate and dicarboxylate metabolism
xpe00640  Propanoate metabolism
xpe00650  Butanoate metabolism
xpe00900  Terpenoid backbone biosynthesis
xpe01100  Metabolic pathways
xpe01110  Biosynthesis of secondary metabolites
xpe01120  Microbial metabolism in diverse environments
xpe01130  Biosynthesis of antibiotics
xpe01200  Carbon metabolism
xpe01212  Fatty acid metabolism
xpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJD13_09855
   00630 Glyoxylate and dicarboxylate metabolism
    BJD13_09855
   00640 Propanoate metabolism
    BJD13_09855
   00650 Butanoate metabolism
    BJD13_09855
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJD13_09855
   00072 Synthesis and degradation of ketone bodies
    BJD13_09855
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJD13_09855
   00310 Lysine degradation
    BJD13_09855
   00380 Tryptophan metabolism
    BJD13_09855
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJD13_09855
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJD13_09855
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJD13_09855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xpe04147]
    BJD13_09855
Enzymes [BR:xpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJD13_09855
Exosome [BR:xpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJD13_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APO99347
UniProt: A0A0G8YAJ2
Position
1855192..1856367
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIRGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIRAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRSGAFADEIVPVTVATRKGEVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSANDAQRRGVTPLARIVGHVTHSQEPEWFTTAPVAAIQSLLG
KLGWQLDDVDLFEINEAFAVVAMAPIKQLGIAHGKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaacgcggtgccggcacccacgcttgccgcggctgccatccggggggcgctcgcgcaa
tcgggtatcgcgcctgccgatatttccgaagtcatcgtcggctgtgtgctgccggccaat
ctcggccaggcacctgcgcgccaggccgcgattgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggcatgaaggcgatcatgttgggacacgac
ctgatcagggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaatttccaggcggtc
gatcacatggcctgggacggcctgaccaacccgtatgacggccaggccatgggcgtattc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgcgatc
gcctcggtggaacgcgcgcaggcggcgcagcgcagcggcgcgtttgccgacgaaatcgtg
ccggtgacggtcgccacgcgcaagggcgaagtcgtcgtggacagcgatgagcagccgggc
aaatccgacgtggccaagattccgacgttgaagccagccttcaagaaggacggcagcgtg
accgcggccagttcctcgagtatttccgatggcgcggcaatcaccgtactgatgagcgcg
aacgacgcgcaacgccgcggcgtgacgccgctggcgcgcatcgtcggccatgtcacccac
tcgcaggagccggaatggttcaccaccgcaccggtcgctgcgattcaatcgctgctcggc
aagctcggctggcaattggacgatgtggaccttttcgaaatcaacgaagccttcgccgtc
gtggcgatggcgccaatcaagcaacttggcatcgcgcacggcaaggtcaatgtgcatggc
ggcgcctgcgcactgggccatccgatcggcgcatccggcgcgcgtttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgcaacgctatgcatcggcggc
ggcgaagcgaccgccatcgctatcgaattgatttaa

DBGET integrated database retrieval system