KEGG   Xanthomonas perforans: BJD13_15830Help
Entry
BJD13_15830       CDS       T04778                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xpe  Xanthomonas perforans
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xpe03016]
    BJD13_15830
Enzymes [BR:xpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BJD13_15830
Transfer RNA biogenesis [BR:xpe03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    BJD13_15830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: APP01965
UniProt: A0A0G8VLA0
Position
complement(3132423..3133208)
Genome map
AA seq 261 aa AA seqDB search
MRCSPLGSGDAVACGVGDADNPPVSISPKHLQILYQDDVLAVVDKPAGLMVHDSKLARGE
DDFLADRLREQLGKPIFLVHRLDRATSGCLLLAFDRDSASALGKALMAREVEKDYLTVCR
GWPAEERFIVDHDLDGGPGKPVKKPAVTHFQRLATGELEIPSTGFTTSRYALLRCQPQTG
RFRQIRRHMKHLSHHMIGDTSHGDGRHNRSFRMLGIHRMLLHAERLGFPHPGGGRRISIT
APLDAEFTKACALFGWDVAQL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgcggtgttcgccgctcggcagcggcgatgcagtggcatgcggtgtcggcgatgcggat
aatccgccggtgagcatatcccccaagcatctgcagattctctaccaggacgatgtcctg
gccgtcgtcgacaaacccgccggcctgatggtccatgacagcaagctggcgcgtggggag
gacgacttcctggccgaccgtctgcgcgagcagctgggcaagccgatctttctggtgcac
cggctcgaccgcgccaccagcggctgcctgctgctggccttcgatcgcgacagcgccagt
gcgctgggcaaggccttgatggcgcgcgaggtggagaaagattatctcaccgtctgtcgc
ggctggccggccgaggagcgcttcatcgtcgaccatgacctggacggcgggccgggcaag
ccggtcaagaagccggccgtgacgcatttccagcgtctggccaccggcgagctggagatt
ccttccaccgggttcaccacctcgcgctacgcactgctgcgctgtcagccgcagaccggc
cgcttccggcagattcgccggcatatgaagcacctgtcccatcacatgatcggcgacacc
agccacggcgacggccgccacaaccgcagtttccgcatgctcggcatccaccgcatgttg
ctgcacgccgaacgcctgggatttccgcatccgggcggtggccggcgcatcagcatcacc
gcgccgctggatgcggagttcaccaaggcgtgtgcgttgtttggttgggacgtggcgcag
ttgtag

DBGET integrated database retrieval system