KEGG   Xanthomonas phaseoli: XppCFBP6546_04485Help
Entry
XppCFBP6546_04485 CDS       T05156                                 

Gene name
XppCFBP6546P_04485
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xph  Xanthomonas phaseoli
Pathway
xph00450  Selenocompound metabolism
xph00970  Aminoacyl-tRNA biosynthesis
xph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XppCFBP6546_04485 (XppCFBP6546P_04485)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XppCFBP6546_04485 (XppCFBP6546P_04485)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xph01007]
    XppCFBP6546_04485 (XppCFBP6546P_04485)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xph03016]
    XppCFBP6546_04485 (XppCFBP6546P_04485)
Enzymes [BR:xph01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XppCFBP6546_04485 (XppCFBP6546P_04485)
Amino acid related enzymes [BR:xph01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XppCFBP6546_04485 (XppCFBP6546P_04485)
Transfer RNA biogenesis [BR:xph03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XppCFBP6546_04485 (XppCFBP6546P_04485)
 Prokaryotic type
   Other AARSs
    XppCFBP6546_04485 (XppCFBP6546P_04485)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ATS29208
UniProt: A0A0A3WAM2
Position
998107..1000191
Genome map
AA seq 694 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAA
EKAGVTPEAFIANIQASHERDFAAFGVTFDHYDSTNSPVNRELTEAFYAKLEAAGHISRR
SVAQFYDTAKGMFLPDRYIKGICPNCGSPDQYGDNCEVCGATYAPTELKEPKSVISGATP
ELRDSEHFFFEVGHFDGFLREWLAGDVALPGVKAKLKEWLDAEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLCSFKTLCAQMGEDFDAHLVAGTQTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTFLDVGLEPEALRYYFAA
KSSGGVDDLDLNLGDFIARVNADLVGKFVNLASRCAGFIGKRFDGKLAEALPDAAQYDRF
VAALAPIREAYERNDAASAIRQTMALADEANKYIDDTKPWVIAKQDGADAQLQSVCTQGL
NLFRILVAALKPILPRTCAEAEAFLSAPMTSWEDVVRPLTAHTIQPYTALFTRIDPKLID
AMTDASKDTMAAPAAPAATTKSAPSKADAKPAAVANPESQTTNPGLIGIDDFAKLDLRIG
KVLVCEFVEGSDKLLRFELDAGDLGKRQILSGIRGSYGEPETLVGRSVVFIANLAPRKMR
FGISEGMILSAGFDGGALALLDADSGAQPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgcactcgtcaccactgccctgccgtacgccaacggcccgctgcatctt
ggccacctggtcggctacatccaggccgatatctgggtgcgcgcgcgccggttgcgcggc
gacaagacctggttcgtctgtgccgacgacacccacggcacaccgatcatgctggccgcc
gagaaggcgggtgtgaccccggaagccttcatcgccaacatccaggccagccacgagcgc
gatttcgccgcgtttggggtgaccttcgaccattacgattcgaccaattcgccggtcaat
cgcgaactcaccgaagccttctacgccaagctcgaggcggcaggccacatcagccggcgc
tcggtggcgcagttctacgacacggccaagggcatgttcctgccggaccgctacatcaag
ggcatctgccccaactgcggcagccccgaccagtacggcgacaactgcgaggtctgcggc
gccacgtatgcgcccaccgagttgaaggaaccgaagtcggtgatctccggcgccaccccg
gagctgcgcgattcggagcatttctttttcgaagtcggccatttcgacggctttctgcgt
gagtggctggctggcgacgtggcattgcccggcgtcaaggccaagctcaaggaatggctg
gatgccgaaggcggcctgcgtgcgtgggatatctcgcgcgatgcgccctacttcggcttc
cagatccccggacagccaggcaagtatttctacgtgtggctggatgcgccgatcggctac
ctgtgcagcttcaagacgctgtgcgcgcagatgggcgaagacttcgatgcgcatctggtc
gccggcacccagaccgagctgcatcatttcatcggcaaggacatcgtcaattttcacggc
ctgttctggccggcggtgctgcacggcaccggccaccgcgcgccaacccgcctgcacgtc
aacggctacctgaccgtggacggcgccaagatgtccaagtcgcgcggcaccttcgtgatg
gcgcggaccttcctggacgtgggcctggaaccggaggcgctgcgttactacttcgccgcc
aagtcctccggcggcgtggacgacctggacctcaacctgggcgatttcatcgcacgggtc
aatgcggatctggtcggcaagttcgtcaacctggccagccgctgcgccggcttcatcggc
aagcgcttcgacggcaagctggccgaggcgctacccgatgccgcgcagtacgaccgcttc
gtcgctgcgctggcgccgatccgcgaagcttacgagcgcaacgatgcagccagcgcgatc
cgccagaccatggcgctggccgacgaggccaacaagtacatcgacgacaccaagccatgg
gtgatcgccaagcaggacggcgccgatgcgcagctgcagtcggtgtgcacgcagggcctg
aacctgttccgcatcctggtggccgcgctcaagccgatcctgccgcgtacctgcgccgaa
gccgaagccttcctgtcggcaccgatgaccagttgggaagacgtggtccgcccgctcacg
gcgcacacgatccagccctacaccgccctgttcacccgtatagaccccaagctgatcgac
gccatgaccgacgcttccaaagacacgatggccgcacctgcggcacctgctgcgaccacc
aagtccgcaccgagcaaggctgacgcaaagcctgccgccgttgcgaatcccgaatcccaa
accaccaatcccggcctcatcggcatcgacgatttcgccaagctcgacctgcgcatcggc
aaggtgctggtgtgcgaattcgtggaaggctcggacaagttgctgcgtttcgaactggac
gccggcgacctgggcaagcggcagatcctctccggcatccgtggcagctacggcgagccg
gagacgttggtgggccgcagcgtggtgttcatcgccaacctggcgccgcgcaagatgcgc
ttcggcatcagcgagggcatgatcctgtcggccggcttcgacggcggcgccctggcgctg
ctggatgccgacagcggcgcgcagccgggcatgcctgtcaggtaa

DBGET integrated database retrieval system