KEGG   Xanthomonas phaseoli: XppCFBP6546_07205Help
Entry
XppCFBP6546_07205 CDS       T05156                                 

Gene name
XppCFBP6546P_07205
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
xph  Xanthomonas phaseoli
Brite
KEGG Orthology (KO) [BR:xph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XppCFBP6546_07205 (XppCFBP6546P_07205)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: ATS29635
UniProt: A0A0A6TFU1
Position
1572585..1572968
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLIARHWQITDGNGR
TEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgggtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgaaggccgctacgcctttgcctacagcatccgcatccagaatgcg
ggcgcggtgcctgcgcgcctgatcgcgcgccattggcagatcaccgatggcaacggtcgc
accgagcaggtggatggcgaaggcgtggtcggcgaacagccgtggctgcgcccgggcgag
gctttccattacacctccggcgtgctgctggagaccgagcagggacagatgcaaggccac
tacgacatggtggccgacgatggcaccgaatttatcgccccgatcgccgccttcgtgctg
agcgtgcccaggacgctgcactga

DBGET integrated database retrieval system