KEGG   Xanthomonas phaseoli: XppCFBP6546_11060Help
Entry
XppCFBP6546_11060 CDS       T05156                                 

Gene name
XppCFBP6546P_11060
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
xph  Xanthomonas phaseoli
Pathway
xph00360  Phenylalanine metabolism
xph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xph00790  Folate biosynthesis
xph01100  Metabolic pathways
xph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    XppCFBP6546_11060 (XppCFBP6546P_11060)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XppCFBP6546_11060 (XppCFBP6546P_11060)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XppCFBP6546_11060 (XppCFBP6546P_11060)
Enzymes [BR:xph01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     XppCFBP6546_11060 (XppCFBP6546P_11060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ATS30260
UniProt: A0A0A6TAS6
Position
2457587..2458477
Genome map
AA seq 296 aa AA seqDB search
MKTAPQRVENQLTDKGYVPVYTIAVVEQPWDGYSADDHATWGTLYRRQRELLVGRACDEF
LQAQDAMGMGDTHIPRFDALNQVLQAATGWTLVGVQGLLPELDFFDHLANRRFPVTWWIR
RPDQIDYIAEPDLFHDLFGHVPLLMNPLFADFMQAYGRGGVKAHGIGPDALQNLTRLYWY
TVEFGLIDTPQGLRIYGAGIVSSKGESLYSLESPAPNRIGFDLQRIMRTRYRIDSFQKTY
FVIDSFAQLMEATAPDFTPIYAELAQQPQVPAGDVLPSDRVIQRGSGEGWSRDGDV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgccccgcaacgcgtcgaaaaccagctcaccgacaagggctatgtgccggtc
tacaccatcgcggtggtggagcagccgtgggacggctacagcgccgacgatcacgccacc
tggggcaccttgtatcggcgccagcgcgagctgctggtcggtcgggcctgcgacgagttc
ctgcaggcgcaggacgcgatgggcatgggcgatacgcacatcccgcgcttcgatgcgctc
aaccaggtgttgcaggccgccaccggctggaccctggtcggcgtgcagggcctgctgccg
gagctggatttcttcgaccatctggccaacaggcgcttcccggtgacctggtggatccgc
cggcccgatcaaatcgattacatcgccgaaccggacttgttccatgacctgttcggccac
gtgccgttgttgatgaacccgctgtttgccgacttcatgcaggcctatggccgcggcggg
gtcaaggcgcacggcatcggcccggacgcgctgcagaacctcacccggctgtattggtac
accgtggaattcggtctgatcgacacgccgcagggcctgcgcatctacggtgccggcatc
gtgtcgtccaagggcgaatcgctgtattcgctggaatcgccggcacccaaccgcatcggg
ttcgacctgcaacgcatcatgcgcacgcgctaccgcatcgacagcttccagaagacctat
ttcgtcatcgacagttttgcgcagctgatggaggccaccgcgccggacttcaccccgatc
tatgccgagcttgcacaacagccgcaggtgccggccggtgatgtgctgccgagcgatcgg
gtgatccagcgcggcagcggcgagggttggagccgcgacggcgacgtgtga

DBGET integrated database retrieval system