KEGG   Xanthomonas phaseoli: XppCFBP6546_14465Help
Entry
XppCFBP6546_14465 CDS       T05156                                 

Gene name
XppCFBP6546P_14465
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xph  Xanthomonas phaseoli
Pathway
xph00220  Arginine biosynthesis
xph00330  Arginine and proline metabolism
xph01100  Metabolic pathways
xph01110  Biosynthesis of secondary metabolites
xph01130  Biosynthesis of antibiotics
xph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    XppCFBP6546_14465 (XppCFBP6546P_14465)
   00330 Arginine and proline metabolism
    XppCFBP6546_14465 (XppCFBP6546P_14465)
Enzymes [BR:xph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XppCFBP6546_14465 (XppCFBP6546P_14465)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ATS30768
UniProt: A0A0A6TZU7
Position
3241236..3242159
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYADLRAGRMPVMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPEALTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDSRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccttgattggcgtccccaccgacatcggcgcgggc
caccgaggtgcgcgcatggggccggaggcgctacgcatcgccggcctgcaggaggcgctg
gtcggccgcggcgtggaggtgcgcgatctgggcaatctggatggcccgcgcaatccctgg
caggcgccacaggccggctaccggcatctggacgaagtggtggcgtggaaccaggcgctg
atggacgccagctatgccgacctgcgtgccgggcgcatgccggtcatgctcggtggcgac
cattgcctgggcatcggctcgatcacggcggtggccaagtactgccgcgagcagggcagg
ccgttgcgggtgctgtggctggatgcgcattcggatttcaacaccagcgaggtgacccct
tcgggcaacgtgcacggcatgccggtggcctgcctgtgcgggctgggccccgaggcgctg
acgcacctgggtggcagtgcgccggcgttgttgcccgagcaggtgcggcagatcggcatc
cgctcggtggacccggaggagaagcggctgatcaagcagcaccgcatcgatgtgtacgac
atgcgctacatcgacgaagccggtatgaagcgcaccatggaagcggcattgcagggcatg
agcgccgatacgcacctgcacgtgagtttcgatgtggatttcctcgaccccagcatcgcg
ccgggcgtgggcaccacggtgcccggtggccccaactaccgcgaggcgcaactggtgatg
gaaatgattgccgacaccgggcgcatggggtcgctggatatcgtcgagctcaacccggtg
ctggacagccgcaatgcgaccgccgaactggcggtggatctggtcgaaagcctgtttggc
aagtcgacgctgatgcgcgattga

DBGET integrated database retrieval system