KEGG   Xanthomonas phaseoli: XppCFBP6546_14805Help
Entry
XppCFBP6546_14805 CDS       T05156                                 

Gene name
XppCFBP6546P_14805
Definition
(GenBank) NADP-dependent 3-hydroxy acid dehydrogenase
  KO
K05886  serine 3-dehydrogenase (NADP+) [EC:1.1.1.276]
Organism
xph  Xanthomonas phaseoli
Brite
KEGG Orthology (KO) [BR:xph00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XppCFBP6546_14805 (XppCFBP6546P_14805)
Enzymes [BR:xph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.276  serine 3-dehydrogenase (NADP+)
     XppCFBP6546_14805 (XppCFBP6546P_14805)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR NmrA Epimerase Polysacc_synt_2 NAD_binding_10 Shikimate_DH F420_oxidored RmlD_sub_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ATS30819
UniProt: A0A0A6TNT4
Position
complement(3311734..3312489)
Genome map
AA seq 251 aa AA seqDB search
MSKTVLITGATSGFGSAAVRRFAAAGWKVIATGRRAERLQALAAELPAGQVHTAAFDMRD
AHALSDAIDAVPAAFAEIDVLVNNAGLALGTAPAQQADLAQWQQMIDTNVTALVTLTHRL
LPALIARRGAIINIASVAATYPYTGGNVYGGTKAFVQQFSLGLRSDLHGTGVRVTSIEPG
MAETEFTLVRTGGNQAASDTLYRGATPMTAEDIAEQIFYVASLPAHLNINRLEIMPVTQS
FAGFQVARDAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaccgtcctgatcactggtgccacctccggattcggcagcgccgccgtgcgc
cgcttcgccgcagccggctggaaggtcatcgccaccggccggcgcgccgaacgcctgcag
gcgctggccgctgaactgccggccgggcaggtacacaccgccgcgttcgacatgcgcgat
gcacacgccttgtcggacgcgatcgacgcggtgccggccgcattcgccgagatcgacgtg
ctggtcaacaacgccggcctggcgctgggcaccgcgcccgcgcagcaggccgacctggcg
cagtggcagcagatgatcgacaccaatgtcacggcgctggtcacgctcacccaccgcctg
ctgccggcgttgattgcgcgccgcggcgccatcatcaacatcgcttcggtcgcggccacc
tacccatacaccggcggcaacgtctacggcggcaccaaggccttcgtgcagcagttttcg
ctgggcctgcgctctgacctgcacggcaccggcgtgcgggtgacctcgatcgaaccgggc
atggccgagaccgaattcaccctggtgcgcaccggcggcaaccaggccgcctcggacacg
ctgtaccgcggcgccaccccgatgacggcagaagacatcgccgaacagatcttctatgtc
gccagcctgccggcgcatttgaatatcaaccgcctggaaatcatgccggtgacgcagtcc
tttgcagggttccaggtggcccgcgacgcgcagtga

DBGET integrated database retrieval system