KEGG   Xanthomonas phaseoli: XppCFBP6546_15425Help
Entry
XppCFBP6546_15425 CDS       T05156                                 

Gene name
XppCFBP6546P_15425
Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
xph  Xanthomonas phaseoli
Pathway
xph00740  Riboflavin metabolism
xph00790  Folate biosynthesis
xph01100  Metabolic pathways
xph01110  Biosynthesis of secondary metabolites
xph02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:xph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    XppCFBP6546_15425 (XppCFBP6546P_15425)
   00790 Folate biosynthesis
    XppCFBP6546_15425 (XppCFBP6546P_15425)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XppCFBP6546_15425 (XppCFBP6546P_15425)
Enzymes [BR:xph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     XppCFBP6546_15425 (XppCFBP6546P_15425)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ATS30925
UniProt: A0A0A3WIK7
Position
complement(3448291..3449424)
Genome map
AA seq 377 aa AA seqDB search
MSSPLPSPSAQAFGDPAAIRCERAASELRAGRPVLLTAADGQARAVLALDSSTAQSYAAF
ARAAGGRHYLFVTPTRAQVLGLSAPQGARVGLIDHSYDQLAALAYLRDTPVPAQWTAGDA
LDAGGVEIARLGLLLPALLAVELRDVHDHAAFAGCQSLALDDLSRGCATSAAAGYELVTR
TPVPLRGLGMSEFVVFRGGVAQRDQVAIVVGQPDLSTAVPVRVHSSCLTGDLFGSLKCDC
GDQLRHGLAKLKELGGGVLLYLDQEGRGTGIAAKMRAYGYQHAGLDTIDADAQLGFGPDE
RRYGSAVAMLRGLGISRIRLLTNNPAKAERLRAAGIVVEDRIAITGDITAENEQYLRTKA
ARAGHALDVDALILAAQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccctcccctcccccagcgcacaggccttcggcgatccggcggcgattcgc
tgtgagcgcgccgcgtccgaactgcgcgccgggcgcccggtcttgctgacggcggccgat
gggcaggcgcgtgcggtgctggcgctggatagcagcacggcgcagtcgtatgcggcgttc
gcccgcgccgcgggggggcgtcactatctcttcgtgacgcccacccgcgcccaggtgctg
ggcctgagcgcgccgcagggtgcgcgcgtaggcctgatcgatcacagctacgaccagctc
gccgcgctggcctacctgcgcgacaccccggtgcccgcgcagtggacggccggcgatgcg
ctggatgccggcggcgtggagatcgcgcggcttggcctgctgctgccggcgctgctggcg
gtggagttgcgcgatgtgcacgaccatgccgcgttcgccggctgccagtcgctggcgctg
gacgatttgagccgcggctgtgccacctccgcggcagccggctacgagctggtgacccgc
accccggtaccgctgcgcggcctgggcatgagcgagttcgtggtgtttcgcggcggcgtg
gcgcagcgcgaccaggtggcgatcgtggtcggccagccggacctgagcactgcggtgccg
gtgcgcgtgcactcgtcgtgcctcaccggcgacctgttcggctcgctcaaatgcgattgc
ggcgaccagctgcggcacggcctggccaagttgaaggagctcggtggcggcgtcctgctg
tatttggaccaggaagggcgtggcaccggcatcgccgccaagatgcgcgcctacggctat
cagcatgcgggcctggacaccatcgatgccgacgcacagctgggctttggtccggacgag
cgccgctacggcagtgcggtggcgatgctgcgcgggctgggcatcagccggatccggctg
ttgaccaataacccggccaaggccgaacgcctgcgtgcggccggcatcgtggtcgaagac
cgcatcgcgatcaccggcgacatcaccgccgaaaacgagcaatacctgcgcaccaaggcc
gcgcgcgccggccacgcgctggatgtggatgcgttgatcctggccgcgcaataa

DBGET integrated database retrieval system