KEGG   Xanthomonas phaseoli: XppCFBP6546_17100Help
Entry
XppCFBP6546_17100 CDS       T05156                                 

Gene name
XppCFBP6546P_17100
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
xph  Xanthomonas phaseoli
Pathway
xph00860  Porphyrin and chlorophyll metabolism
xph01100  Metabolic pathways
xph01110  Biosynthesis of secondary metabolites
xph01120  Microbial metabolism in diverse environments
Module
xph_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XppCFBP6546_17100 (XppCFBP6546P_17100)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xph01007]
    XppCFBP6546_17100 (XppCFBP6546P_17100)
Enzymes [BR:xph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     XppCFBP6546_17100 (XppCFBP6546P_17100)
Amino acid related enzymes [BR:xph01007]
 Aminotransferase (transaminase)
  Class III
   XppCFBP6546_17100 (XppCFBP6546P_17100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATS31202
UniProt: A0A0A6TG58
Position
complement(3817317..3818606)
Genome map
AA seq 429 aa AA seqDB search
MNHSRSHALFAQAQTLLPGGVNSPVRAFKSVGGEPFFVARADGPYLFDVDDNRYIDYVGS
WGPMIAGHNHPAVREAVEQSIRNGLSFGAPCAAEVTMAQTIARLVPSCEMVRMVNSGTEA
TLSAVRLARGATGRNRIIKFEGCYHGHGDSFLVKAGSGMLTLGVPTSPGVPAGLSELTAT
LSFNDFEGATALFDEIGAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDE
VMTGFRVALGGAQAHYGVTPDLTTFGKIIGGGMPVGAYGGRRDLMEQVAPAGPIYQAGTL
SGNPVAMAAGLAMLELVQEPGFHTRLSEATSMLCEGLEDAARAAGIAVTTNQVGGMFGLF
FTDDVVESYAQATACDITSFNRFFHAMLQRGVYLAPSAYEAGFMSSAHDEAVIEATLAAA
REAFADVAR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaccattcccgctcccacgccctgttcgcccaggcgcagactttgctaccgggcggc
gtcaactcgccggtacgggcgttcaagtcggtcggcggcgagccgttcttcgtggcgcgc
gccgatggcccctatctgttcgatgtcgacgacaaccgctatatcgactatgtgggctcg
tgggggccgatgattgccgggcacaaccacccggccgtgcgcgaagcggtcgagcagtcg
atccgcaacgggctctcgttcggtgcaccgtgcgcagccgaagtgacgatggcgcagacc
atcgcccggctggtgccctcctgcgagatggtgcgcatggtcaactccggtaccgaagct
acgctgtcggcggtacgcctggcgcgtggcgccaccgggcgcaatcgcatcatcaagttc
gaaggctgttatcacggccatggcgattcgttcctggtcaaggccggcagcggcatgctg
accctgggcgtaccgacctcgcccggcgtacccgcagggctgagcgagctgaccgccacg
ctgagcttcaacgacttcgagggcgccaccgcgctgttcgacgagatcggtgcggaggtg
gcggcggtgatcatcgagccggtggtcggcaatgccaactgcattccgccgcaggccggc
tatctgcagcatctgcgcacgctgtgcactaggcacggcgcgttgctgatcttcgacgaa
gtgatgaccggcttccgcgtcgcgctcggtggtgcgcaggcgcattacggcgtgaccccg
gacctgaccaccttcggcaagatcatcggcggcggcatgccggtgggcgcctacggcggc
cgccgcgacttgatggagcaggttgctccggccgggccgatctaccaggccggcaccttg
tcgggcaacccggtggccatggccgcaggcctggcgatgctggagctggtgcaggagccg
ggcttccacacgcgcttgagcgaggccaccagcatgctgtgcgaaggccttgaagatgcc
gcgcgcgcagccggcattgccgtgaccaccaaccaggttggcggcatgttcgggctgttc
ttcaccgacgacgtcgtggagagctacgcacaggccacggcgtgcgacatcaccagcttc
aaccgattcttccacgcgatgctgcagcggggcgtctacctggcgccctcggcgtacgaa
gccggcttcatgtccagtgcgcacgacgaggcggtgatcgaagccacgctggcggcagcg
cgcgaggcgtttgcggacgtggcgcgctga

DBGET integrated database retrieval system