KEGG   Xenorhabdus poinarii: XPG1_0069Help
Entry
XPG1_0069         CDS       T03805                                 

Definition
(GenBank) protein of unknown function
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xpo  Xenorhabdus poinarii
Pathway
xpo00071  Fatty acid degradation
xpo00280  Valine, leucine and isoleucine degradation
xpo00310  Lysine degradation
xpo00362  Benzoate degradation
xpo00380  Tryptophan metabolism
xpo00620  Pyruvate metabolism
xpo00630  Glyoxylate and dicarboxylate metabolism
xpo00640  Propanoate metabolism
xpo00650  Butanoate metabolism
xpo00900  Terpenoid backbone biosynthesis
xpo01100  Metabolic pathways
xpo01110  Biosynthesis of secondary metabolites
xpo01120  Microbial metabolism in diverse environments
xpo01130  Biosynthesis of antibiotics
xpo01200  Carbon metabolism
xpo01212  Fatty acid metabolism
xpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XPG1_0069
   00630 Glyoxylate and dicarboxylate metabolism
    XPG1_0069
   00640 Propanoate metabolism
    XPG1_0069
   00650 Butanoate metabolism
    XPG1_0069
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XPG1_0069
   00072 Synthesis and degradation of ketone bodies
    XPG1_0069
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XPG1_0069
   00310 Lysine degradation
    XPG1_0069
   00380 Tryptophan metabolism
    XPG1_0069
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XPG1_0069
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XPG1_0069
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XPG1_0069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xpo04147]
    XPG1_0069
Enzymes [BR:xpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XPG1_0069
Exosome [BR:xpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XPG1_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CDG19724
UniProt: A0A068QY95
Position
complement(80222..80458)
Genome map
AA seq 78 aa AA seqDB search
MELQSFAAQALAVSHSCGIPAERINPYGGAIALGHTIGASGCRIRVTLIHGLIRENCNKG
IAALCIGGGEGIALSVTR
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
ttggaacttcagtcattcgcagcacaggctctagctgtttctcattcctgcggtattcct
gctgaacgcataaatccttatggtggagcaatcgcactagggcacaccattggcgcctct
ggatgtcggatacgtgtaacattaatacacggactcattcgagaaaattgcaataaagga
attgcggcgctgtgcatcggtggaggggaaggcattgctttgagtgtcactcgctaa

DBGET integrated database retrieval system