KEGG   Xenorhabdus poinarii: XPG1_0159Help
Entry
XPG1_0159         CDS       T03805                                 

Gene name
hemN
Definition
(GenBank) Oxygen-independent coproporphyrinogen-III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
xpo  Xenorhabdus poinarii
Pathway
xpo00860  Porphyrin and chlorophyll metabolism
xpo01100  Metabolic pathways
xpo01110  Biosynthesis of secondary metabolites
Module
xpo_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:xpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XPG1_0159 (hemN)
Enzymes [BR:xpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     XPG1_0159 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: CDG19814
UniProt: A0A068QYG2
Position
162450..163823
Genome map
AA seq 457 aa AA seqDB search
MSEQTIVWDLPLIQKYNYSGPRYTSYPTALEFNHQYDATAFSQAAARYLERPLSLYIHIP
FCHKLCYFCGCNKQVTRQKHKADEYLTVLEKEIAARAKLFSQRKVSQMHWGGGTPTYLDK
TQISRLMSMLRNHFHFLPDAELSIEIDPREIELNVIDHLRNEGFNRLSMGVQDFNKDVQR
SVNREQDEAFIFNLINRARETGFTSTSIDLIYGLPKQTPESFAFTLQRVLALSPDRLSVF
NYAHLPDLFAAQRKIKAHDLPSAMQKLAILQETISTLTGNGYQFIGMDHFARPEDELAIA
QRKGLLHRNFQGYTTQGECDLLGMGVSAISMLGDSYAQNQKDLKTYYAAVEAQGEALWRG
LVLTPDDCIRRDVIKDLICNFRLNFADIEQRYGLNFADYFAEDLQLLAPLAEDGLVELTG
SQIQILPKGRLLIRNVCMCFDRYLRNQMRQRQFSQVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaaaccattgtttgggatctgcctttgatccaaaaatacaattattcaggg
cctcgttatacgtcgtatccgacagcattagaatttaaccaccagtacgatgcgacggct
ttttcccaggccgctgcccgttatcttgagcgccctctctccctgtatatccatatccca
ttctgccataagctttgttatttctgtggctgcaataaacaggtcacccggcaaaaacac
aaagcagatgaatatctgacggtgctggaaaaagagattgctgccagggctaaattattt
tctcagcggaaagttagccagatgcattggggaggcggtacaccaacctatctggacaaa
acacaaatcagtcgattgatgtcgatgttgcgaaaccatttccattttctgccggatgct
gaactttccattgaaattgatccacgtgaaattgaactcaatgtcattgatcacctgcgc
aatgaaggctttaaccgcctgagcatgggggtacaggatttcaataaagacgtacagcgt
tcagtgaatcgtgagcaggatgaagcatttattttcaacctgatcaatcgcgctcgtgaa
accggttttacctccaccagcattgacctgatttatggtttgccaaagcaaactcctgaa
agttttgcttttacattacagcgcgtgctggcattgtcacctgatcgcctgagtgtcttt
aactatgcccatttaccggatttatttgcggcgcagcgtaagattaaggcgcatgattta
ccgagtgcgatgcagaagttggctattttacaagaaacgatttcaaccctgacaggtaac
ggctatcagtttatcggcatggatcactttgcccgtccggaggatgaattggcgattgct
caacgaaaaggtctcttacatcgcaattttcagggatataccacgcagggggaatgcgat
ttattaggtatgggcgtttctgctatcagtatgttgggggatagctatgctcagaaccag
aaagatctgaaaacttactatgctgcggtagaagcacaaggagaggctttgtggcggggg
ttggtactgacgccggatgattgtattcgccgtgatgtgatcaaagatcttatctgtaac
ttccggctgaattttgctgatattgagcagcgttatggactgaatttcgctgattatttt
gccgaagacctgcaactgttagccccattggcagaggacggactggtggaactgacggga
tcgcagatccaaatattgccaaaagggcgcttgctaatccggaatgtttgtatgtgtttt
gaccgctacctgcgtaatcagatgcgtcaacggcaattttcccaggtgatataa

DBGET integrated database retrieval system