KEGG   Xenorhabdus poinarii: XPG1_2737Help
Entry
XPG1_2737         CDS       T03805                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xpo  Xenorhabdus poinarii
Brite
KEGG Orthology (KO) [BR:xpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xpo03016]
    XPG1_2737 (truC)
Enzymes [BR:xpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     XPG1_2737 (truC)
Transfer RNA biogenesis [BR:xpo03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    XPG1_2737 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CDG22389
UniProt: A0A068R5V2
Position
complement(2637713..2638465)
Genome map
AA seq 250 aa AA seqDB search
MLDIIYQDEHLVAVNKPAGWLVHRSWLDRHETVFVMQTLRDQIGQHVFPVHRLDRPTSGV
LLMALSSQVARTLSQQFECHNIQKTYHAVVRGYVEGNDIIDYALMEQLDKIADKFADTQR
EAQSAVTAYRSLAKVECPVAIGRYPTSRFSLLELMPKTGRKHQLRRHMSHIRHPIIGDTT
HGDLRQNRGVAKYYQTSRLMLHASHLQLRHPVTGVDLFLTARWEPSWQHLLEQFGWQGIV
PDLECLTIHQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgctggatattatttatcaggatgaacatcttgttgcagttaataagccagccggatgg
ttagttcaccgtagctggctggatcgccatgaaaccgtgtttgtgatgcaaaccctgcgt
gatcaaattgggcaacatgttttccctgtccatcgtctggacaggccaacctccggtgtt
ttattaatggcactttcaagtcaagtcgccagaacactttcccaacagtttgaatgccac
aatatacaaaaaacctatcacgcagtggttaggggttatgtcgaaggtaatgatattatc
gactacgccttaatggagcagttggataaaattgcagacaaatttgcggatacccagcga
gaagcgcaatcagctgtgacggcttaccgttcattggcaaaagtagagtgtccggttgca
atagggcgttatccaacatcccgtttcagtcttttggaattgatgccaaaaaccggtcgt
aagcatcaattacgcagacatatgtcacatattcgacacccgattattggggataccacc
cacggtgatttgcgacaaaaccgaggtgtggctaaatattatcagacaagcaggttaatg
ttacatgccagccaccttcaactcaggcatcctgtgaccggtgtcgatctgtttctgacg
gctcggtgggaaccatcatggcagcatttacttgaacaatttggctggcagggtattgtg
cctgatctggaatgtctgactattcatcagtga

DBGET integrated database retrieval system