KEGG   Xenorhabdus poinarii: XPG1_3381Help
Entry
XPG1_3381         CDS       T03805                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
xpo  Xenorhabdus poinarii
Brite
KEGG Orthology (KO) [BR:xpo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XPG1_3381 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: CDG23017
UniProt: A0A068R6W6
Position
3319691..3320068
Genome map
AA seq 125 aa AA seqDB search
MLNEPRVYIQVQSTYVESQSQPEQQRFVFAYTISIHNLGHFPVQLISRYWRITNSDGHLT
EVQGEGVVGQQPLIPPGTEYCYRSGAILETPLGTMEGYYEMLDHNGRPFRAPIPVFRLAI
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgaaccaagagtttatattcaagtacaaagtacttatgtagaaagtcaatca
caaccggaacaacaacgttttgtgtttgcttatacaatatcaattcacaatcttgggcat
ttccctgtgcaactgattagccgttactggcgaattactaacagtgatggccacctaacc
gaagttcagggtgaaggggttgtgggacaacaacctttgatcccaccgggaaccgaatat
tgctaccgtagtggtgctattttggaaacgcctctgggaacgatggagggctactatgaa
atgcttgatcacaatggtcgtccattccgtgcccctatccccgtcttccggctggctatt
ccaacgctgataaattaa

DBGET integrated database retrieval system