KEGG   Xanthomonas sacchari: SB85_02970Help
Entry
SB85_02970        CDS       T03566                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00790  Folate biosynthesis
xsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SB85_02970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xsa04147]
    SB85_02970
Enzymes [BR:xsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     SB85_02970
Exosome [BR:xsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB85_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AJC44880
UniProt: A0A0A8DS95
Position
740481..740822
Genome map
AA seq 113 aa AA seqDB search
MNDLIPLAQAHCSPCKGSEYRLTQARLAELLPQVPGWEVVENGNAISRTFRFPDYYRTLA
FVNALAWIAHREDHHPDLGVHYDRVVVRYSTHDVGGLSENDFICAAKASALPE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgatcccgctcgcccaggcccattgctcgccctgcaagggcagcgaatac
agactgacccaggcgcgcctggccgaactgctgccgcaggtgccaggctgggaagtggtc
gagaacggcaacgcgatcagccgcaccttccgcttccccgactattaccgcaccctggcc
ttcgtcaacgcgctggcctggatcgcgcaccgcgaagaccaccaccccgacctgggcgtg
cactacgaccgcgtggtggtgcgctattccacccacgacgtcggtggcctcagcgagaac
gacttcatctgcgccgccaaggcgtccgctcttccggaatga

DBGET integrated database retrieval system