KEGG   Xanthomonas sacchari: SB85_06435Help
Entry
SB85_06435        CDS       T03566                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00071  Fatty acid degradation
xsa00072  Synthesis and degradation of ketone bodies
xsa00280  Valine, leucine and isoleucine degradation
xsa00310  Lysine degradation
xsa00362  Benzoate degradation
xsa00380  Tryptophan metabolism
xsa00620  Pyruvate metabolism
xsa00630  Glyoxylate and dicarboxylate metabolism
xsa00640  Propanoate metabolism
xsa00650  Butanoate metabolism
xsa00900  Terpenoid backbone biosynthesis
xsa01100  Metabolic pathways
xsa01110  Biosynthesis of secondary metabolites
xsa01120  Microbial metabolism in diverse environments
xsa01130  Biosynthesis of antibiotics
xsa01200  Carbon metabolism
xsa01212  Fatty acid metabolism
xsa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SB85_06435
   00630 Glyoxylate and dicarboxylate metabolism
    SB85_06435
   00640 Propanoate metabolism
    SB85_06435
   00650 Butanoate metabolism
    SB85_06435
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SB85_06435
   00072 Synthesis and degradation of ketone bodies
    SB85_06435
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SB85_06435
   00310 Lysine degradation
    SB85_06435
   00380 Tryptophan metabolism
    SB85_06435
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SB85_06435
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SB85_06435
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SB85_06435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xsa04147]
    SB85_06435
Enzymes [BR:xsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SB85_06435
Exosome [BR:xsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB85_06435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJC45450
UniProt: A0A0A8DTZ3
Position
1570961..1572166
Genome map
AA seq 401 aa AA seqDB search
MTEIVIAAAKRTAIGAFLGQFNGVPTPTLGAAAIRAALEQSGIPAADVSEVIMGCVLPAN
LGQAPARQAARAAGVPDGTGATTINKVCGSGMKAVMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPDDGQAMGVFGEATAEKFGFSRQDQDAFAI
ESVNRAQAAQRDGAFSDEIVPVAVATRKGEVRVDSDEQPGKSDVTKIPALKPAFKKDGTV
TAASSSSISDGAAALVLLGADEAARRGVAPLARIVGHTTFSQAPEWFTTAPVGAIRKLLD
QVGWSLDQVDLFEINEAFAVVAMVPIKELGLDHAKVNVHGGACALGHPIGASGARLLVTL
LNALRSRGGRRGIATLCIGGGEATAVAIELILLNLTPETQK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgtcatcgccgcggccaagcgcaccgccatcggcgcgttcctgggccag
ttcaacggcgtgcccacgccgacgctgggcgccgcggccatccgcgccgcgctggagcag
tccggcatccccgccgccgacgtttccgaagtcatcatgggctgcgtgctgccggccaac
ctcggccaggccccggcacgtcaggccgcgcgcgcggccggcgtgcccgacggcaccggc
gccaccaccatcaacaaggtctgcggctcgggcatgaaggcggtgatgctgggacacgac
ctgatcaaggccggttcggccagcatcgtcgtcgccggcggcatggagtcgatgagcaac
gcgccgcacctgctgccgaactcgcgtaccggcaaccgctacggcaacttccaggcggtc
gaccacatggcctgggacggcctgaccaatcccgacgacggccaggcgatgggcgtgttc
ggcgaggccaccgcggagaagttcggcttcagccgccaggaccaggacgcgttcgcgatc
gaatcggtgaaccgcgcgcaggccgcgcagcgcgatggcgccttctccgacgagatcgtc
ccggtcgccgtggccacccgcaagggcgaggtacgggtcgacagcgacgagcagccgggc
aagtccgacgtgaccaagatcccggcgctgaagccggcgttcaagaaggacggcacagtc
accgcggccagctcctcgagcatctccgacggcgccgccgcgctggtgctgctgggcgcc
gacgaggccgcccgccgcggcgtcgcgccgctggcgcggatcgtcggccacacgaccttc
tcgcaggcgccggaatggttcaccaccgcgccggtgggcgcgatccgcaagctgctcgac
caggtcggctggagcctggaccaggtcgatctgttcgagatcaacgaagccttcgccgtg
gtggcgatggtgccgatcaaggaactgggcctggaccacgccaaggtcaatgtccacggc
ggcgcctgcgcgctcggccatccgatcggcgcctccggcgcgcggctgctggtgacattg
ctaaatgcgttgcgcagccgtggcggccgccgcggaatcgcgacactgtgcattggtggc
ggcgaagcgacagcggtcgccatcgaattgattttattgaatttaacccctgaaacacaa
aaatga

DBGET integrated database retrieval system