KEGG   Xanthomonas sacchari: SB85_06775Help
Entry
SB85_06775        CDS       T03566                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SB85_06775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xsa02000]
    SB85_06775
Enzymes [BR:xsa01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     SB85_06775
Transporters [BR:xsa02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    SB85_06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 SbcCD_C AAA_30 AAA_23 Zeta_toxin AAA_22 AAA_25 AAA_16 MMR_HSR1 DUF2791
Motif
Other DBs
NCBI-ProteinID: AJC45511
UniProt: A0A0A8E081
Position
complement(1661829..1663340)
Genome map
AA seq 503 aa AA seqDB search
MHPLVLEAQGLSKAYAGVAALEDVALRLRGGEIHALMGQNGAGKSTLIKLLTGVTTADAG
RIVLDGAVVAPASPQQAQRLGISTVYQEVNLCPNLSVAENLFVGRYPLRGWPRRIDWRRL
EREAEAGLQRLGIAIDVRRALGTYPVAVQQMVAIARAVGVSARVLILDEPTSSLDEGEVA
ELFRVMRALRDGGMAILFVTHFLDQVYAVADRISVLRNGRLVGEYTPDALPAPQLVAAMV
GRALDPASAAAATVRAAAPEEAAPLLQAQGLGRRGQLQPTDLQLRSGEVLGLAGLLGAGR
TELARLLFGLDRADHGGVSIDGRAVALRGPPDAIAHGLALCPEERKTEGIVAELSVRENI
VLALQARMGLRRFLAPAEQLRIAQGYVDVLGIKTASLETPVGLLSGGNQQKVVLARWLAT
RPRLLILDEPTRGIDIAAKQDIMTRILALAREGMAVLFISAEVAELARIADRIAVLRERR
LVGELPGGCGERAIFDLITGSAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctggtgctggaggcgcagggactgagcaaggcctacgccggcgtggccgcg
ctggaggacgtggcgctgcgtttgcgcggcggcgagatccacgcgctgatgggccagaac
ggcgccggcaagtcgaccctgatcaagctgctgaccggagtgaccaccgccgatgccggg
cgcatcgtgctggacggcgccgtcgtcgcgccggcctcgccgcagcaggcgcaacggctc
ggcatcagcaccgtgtaccaggaagtgaacctgtgcccgaacctgtcggtggccgagaac
ctgttcgttggccgctatccgctgcgcggctggccgcggcgcatcgactggcgccggctc
gagcgcgaggccgaggccggcctgcagcgcctgggtatcgccatcgacgtgcggcgcgcg
ctgggcacctatccggtggcggtgcagcagatggtggcgatcgcgcgcgcggtcggcgtg
tcggcgcgggtgctgatcctcgacgaacccacctccagtctcgacgagggcgaggtggcc
gagctgttccgggtgatgcgcgcgctgcgcgatggcggcatggcgatcctgttcgtcact
cacttcctggaccaggtgtacgcggtggccgaccgcatcagcgtgctgcgcaacggtcgt
ctggtcggcgaatacacgcccgacgcactgcccgcgccgcagttggtggcggcgatggtc
gggcgcgcgctcgacccggccagcgccgcggccgccacggtgcgcgcggccgcgcccgag
gaggctgcgccgctgctgcaggcgcagggcctgggccgacgtggccagttgcaaccgacc
gatctgcaactgcgcagcggcgaggtgctgggcctggctggcctgctcggtgccggccgc
accgaactggcgcggttgttgttcgggctggaccgcgccgatcatggcggcgtgtcgatc
gacggccgcgccgtggccttgcgcggcccgcccgatgccatcgcccacggcctcgcgctg
tgcccggaggaacgcaagaccgaaggcatcgtcgccgagctgtcggtgcgcgagaacatc
gtgctggccttgcaggcgcggatgggcctgcgccggttcctggccccggccgagcagctg
cgcatcgcgcagggctatgtggacgtgctgggcatcaagaccgccagcctggagacgccg
gtggggctgctgtccggcggcaaccagcagaaggtggtgctggcgcgctggctggcgacg
cggccgcggctgctgatcctggacgaacccacccgcggcatcgacatcgccgccaagcag
gacatcatgacccggatcctggccctggcccgcgagggcatggcggtgctgttcatctcc
gccgaggtcgccgagctcgcgcgcatcgccgaccgcatcgcggtgctgcgcgagcgccgc
ctggtcggcgagctgcccggcggctgcggcgagcgtgcgatcttcgacctgatcaccggg
agcgcggcatga

DBGET integrated database retrieval system