KEGG   Xanthomonas sacchari: SB85_07280Help
Entry
SB85_07280        CDS       T03566                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00230  Purine metabolism
xsa00250  Alanine, aspartate and glutamate metabolism
xsa01100  Metabolic pathways
Module
xsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SB85_07280
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SB85_07280
Enzymes [BR:xsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SB85_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AJC45605
UniProt: A0A0A8DUI4
Position
complement(1776685..1777977)
Genome map
AA seq 430 aa AA seqDB search
MGQSVVVLGAQWGDEGKGKIVDLLTEEIGAVVRFQGGHNAGHTLVINGKKTVLHLIPSGI
LRDDALCLIGNGVVISPAALRKEIEELETSGVEVRSRLKISPAAPLIMPYHIALDQAREK
AAGGKAIGTTGRGIGPAYEDKVARRGIRVADLHYPPQLEELLRTALDYHNFVLTKYLGVE
AVDFQKTFDEALAFGEYVQPMKSDVAGILHDLRKQGKRVLFEGAQGALLDIDHGTYPYVT
SSNTTVGGALAGTGVGAQDIDYVLGIAKAYATRVGGGPFPTELDDEIGQGIRDRGAEYGA
STGRPRRCGWMDIVALKRAVAINGISGLCITKLDVLDGMEKLKVCIAYEYRGKRTEYAPL
DAQGWEECTPVYLEFPGWSENTHGITVWDELPPAARAYLRALEELAGCPISIVSTGPDRE
HTMVLQDPFA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagtcagttgtcgtgctcggcgcccagtggggcgatgaaggcaaaggcaagatc
gtcgatctgctcaccgaggaaatcggtgccgtcgtgcgtttccagggcggccacaacgcc
ggccacaccctcgtcatcaacggcaagaagaccgtcctgcacctgatcccgtccggcatc
ctgcgcgacgatgcgctgtgcctgatcggcaacggcgtggtgatctccccggccgcgctg
cgcaaggaaatcgaggagctggagacctccggcgtggaagtgcggtcgcgcctgaagatc
tcgccggccgcgccgctgatcatgccgtaccacatcgccctggatcaggcccgcgagaag
gccgccggcggcaaggccatcggcaccaccggccgcggcatcggcccggcctacgaagac
aaggtggcgcgccgcggcatccgcgtcgccgacctgcattacccgccgcagctggaagag
ctgctgcgcaccgcgctggactaccacaacttcgtgctgaccaagtacctgggcgtggaa
gcggtcgacttccagaagaccttcgacgaagcgctggccttcggcgagtacgtgcagccg
atgaagtccgacgtcgccggcatccttcacgacctgcgcaagcagggcaagcgcgtgctg
ttcgaaggcgcgcagggtgcgctgctggacatcgaccacggcacctatccctacgtcacc
agttccaacaccactgtcggcggcgcactggccggcaccggcgtgggcgcgcaggacatc
gactacgtgctgggcatcgccaaggcctacgccacccgcgtcggcggcggcccgttcccg
accgaactggacgacgagattggccagggcatccgcgaccgcggcgccgagtacggcgcc
tccaccggccgtccgcgccgctgcggctggatggacatcgtcgcgctcaagcgcgcggtg
gccatcaacggcatctccggcctgtgcatcaccaagctcgacgtgctcgacggtatggag
aagctgaaggtgtgcatcgcctacgaataccgcggcaagcgtaccgagtacgcgccgctg
gacgcgcagggctgggaagagtgcacccccgtgtacctggagttcccgggctggagcgag
aacacccacggcatcaccgtgtgggacgaactgccgcccgccgcccgcgcctacctgcgt
gcgctggaggaactggccggctgcccgatctcgatcgtctccaccggcccggatcgcgag
cacaccatggtgctgcaggatccgttcgcctga

DBGET integrated database retrieval system