KEGG   Xanthomonas sacchari: SB85_13705Help
Entry
SB85_13705        CDS       T03566                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xsa  Xanthomonas sacchari
Pathway
xsa00071  Fatty acid degradation
xsa00072  Synthesis and degradation of ketone bodies
xsa00280  Valine, leucine and isoleucine degradation
xsa00310  Lysine degradation
xsa00362  Benzoate degradation
xsa00380  Tryptophan metabolism
xsa00620  Pyruvate metabolism
xsa00630  Glyoxylate and dicarboxylate metabolism
xsa00640  Propanoate metabolism
xsa00650  Butanoate metabolism
xsa00900  Terpenoid backbone biosynthesis
xsa01100  Metabolic pathways
xsa01110  Biosynthesis of secondary metabolites
xsa01120  Microbial metabolism in diverse environments
xsa01130  Biosynthesis of antibiotics
xsa01200  Carbon metabolism
xsa01212  Fatty acid metabolism
xsa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SB85_13705
   00630 Glyoxylate and dicarboxylate metabolism
    SB85_13705
   00640 Propanoate metabolism
    SB85_13705
   00650 Butanoate metabolism
    SB85_13705
  Lipid metabolism
   00071 Fatty acid degradation
    SB85_13705
   00072 Synthesis and degradation of ketone bodies
    SB85_13705
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SB85_13705
   00310 Lysine degradation
    SB85_13705
   00380 Tryptophan metabolism
    SB85_13705
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SB85_13705
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SB85_13705
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SB85_13705
Enzymes [BR:xsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SB85_13705
Exosome [BR:xsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB85_13705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AJC46642
UniProt: A0A0A8DZ27
Position
3305150..3306430
Genome map
AA seq 426 aa AA seqDB search
MPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERYGLHGQQLGEVAMGAVI
KHSSDWNLGREAALSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIGGGSDT
TSEVPIVYGKKLRARLLAANRAKSTGDKLRALTRGFKFAELKPEFPGVAEPRTGKSMGDH
CEDMAKQWNISRDSQDAWAVSSHHKLAAAYERGFFADLIAPFRGVERDNILRADTSLEKL
ATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWAQAHGHVPMAYLRDAQVSAVDF
VHGEGLLMAPTVAVPEMLKRHGLRLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRTRLGL
DAPLGQIDPAKINPVGSSLATGHPFAATGARIVATVAKQLVERGGGRALISICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagcccgtcccgtcgccattctcggcggcgtccgcattccgttttgccggcag
aacacggcgtatgcggatgtcgggaacctcggcatgtcggtgcgcacgctgggcgcgctg
gtcgagcgttacgggctgcacgggcagcagctgggcgaagtggcgatgggcgcggtgatc
aaacattccagcgactggaacctgggccgcgaggcggcgctgtcctccgggctgtcgccg
ctgactccgggcatcaccctgcaacgcgcctgcggcaccagcctggacagcatcatcacc
gtcgccaacaagatcgcgctggggcagatcgagtcgggcatcggcggcggctcggacacc
acctccgaagtgccgatcgtctacggcaagaaactgcgcgcgcgcctgctggcggccaac
cgtgccaagagcaccggcgacaagctgcgcgcgctgacccgcggcttcaagttcgccgag
ctcaagcccgagttcccgggcgtggccgagccgcgcaccggcaagagcatgggcgaccac
tgcgaggacatggccaagcagtggaacatctcgcgcgattcgcaggacgcctgggcggtg
tcctcgcaccacaagctggccgccgcctacgagcgcggcttcttcgccgacctgatcgcg
ccgttccgcggcgtggagcgcgacaacatcctgcgcgcggatacctcgctggagaagctg
gccacgctgaagccggccttcgacaaggtcagcggccgcggcaccctgaccgcggccaac
tcgaccccgctgaccgacggcgccgccgcggtgctgctggcctcggaagaatgggcgcag
gcgcatggccacgtgccgatggcctatctgcgcgatgcgcaggtgtcggcggtggatttc
gtgcacggcgaaggcctgctgatggcgccgaccgtggccgtgccggagatgctcaagcgc
cacggcctacgcctgcaggacttcgacatctacgagatccacgaggccttcgccgcgcag
gtgctgtgcaccctgcgtgcctgggagagcgaggactactgccgcacccggctgggcctg
gacgcgccgctggggcagatcgatccggccaagatcaacccggtgggctcgtcgctggcc
accggccatccgttcgccgcgaccggcgcacgcatcgtcgccaccgtcgccaagcagctg
gtcgaacgcggcggcggccgcgcgctgatctccatctgcaccgccggcggcatgggcgtg
gtggcgatcgtcgaacgctga

DBGET integrated database retrieval system