KEGG   Xanthomonas sacchari: SB85_13850Help
Entry
SB85_13850        CDS       T03566                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
xsa  Xanthomonas sacchari
Brite
KEGG Orthology (KO) [BR:xsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xsa03016]
    SB85_13850
Enzymes [BR:xsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     SB85_13850
Transfer RNA biogenesis [BR:xsa03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    SB85_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJC47673
UniProt: A0A0A8E107
Position
3334969..3335721
Genome map
AA seq 250 aa AA seqDB search
MNTDADSLQILYQDPLLAVVDKPARLMVHDSKLARGEDDFLADRLRAQLGRPIFLVHRLD
RATSGCLLLAFDRDTASVLGKALMGGEVDKDYLAICRGWPAEDRFEVDHDLDGGPGKPLK
KPAQTRFERLACGELQVPSGEFATSRYALLRCSPVTGRFRQIRRHLKHLSHHLIGDTSHG
DGRHNRIFRMQGVHRMLLHAERLAFPHPDGHRIAVTAPLDAEFLRAFGLFGWDPAPWQVG
RVDAVGMAAA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgaataccgacgccgattccctgcagatcctctatcaagacccactgctcgccgtggtc
gacaagcccgcccggctgatggtccacgacagcaagctcgcccgcggcgaggacgatttc
ctcgccgaccgtctgcgcgcacagctgggtcggccgatcttcctggtgcaccggctcgac
cgcgccaccagcggttgcctgctgctggccttcgaccgcgacaccgccagcgtgctgggc
aaggcgctgatgggcggcgaggtggacaaggattacctggcgatctgccgcggctggccg
gccgaagaccgcttcgaggtcgaccacgacctcgacggcggccccggcaagccgctgaag
aaaccggcgcagacccgcttcgagcgcctggcctgcggcgaactgcaggtaccctcgggc
gagttcgccacctcgcgctatgcgctgctccgctgcagcccagtgaccgggcgcttccgg
cagatccgccgccacctcaagcacctctcgcatcacctgatcggcgacaccagccatggc
gatggccgccacaaccgcatcttccgcatgcagggcgtgcaccgcatgctgctgcacgcc
gagcgcctggcgtttccgcatccggacggccatcggatcgcggtgacggcgccgctggat
gcggaattcctgcgggcgttcgggttgttcggctgggatcccgcgccgtggcaggtgggg
cgagtcgatgccgtcggcatggcggcggcatag

DBGET integrated database retrieval system