KEGG   Xanthomonas translucens: FD63_03430Help
Entry
FD63_03430        CDS       T03961                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
xtn  Xanthomonas translucens
Pathway
xtn00670  One carbon pool by folate
xtn00790  Folate biosynthesis
xtn01100  Metabolic pathways
Module
xtn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xtn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FD63_03430
   00670 One carbon pool by folate
    FD63_03430
Enzymes [BR:xtn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FD63_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AKK66600
UniProt: A0A0G3LJY9
Position
793241..793741
Genome map
AA seq 166 aa AA seqDB search
MTLIAALDRGNAIGRDNDLPWRLPDDLKRFKALTLGKPVLMGRKTAQSLGRALPGRLNLV
LTRSGQVPFEGMQAVASLSAAIEAAQASGAGELAVIGGGDIFALALPHAEMLYLTHVDTL
VEGADAHFPAFDPAQWEVVARQAHAADARHALAFEFVDYRRRRSAP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ataaccctgatcgccgcgctcgatcgcggcaacgccatcggccgcgacaacgacctgccg
tggcgcttgccggacgacctgaagcgcttcaaggcgctgaccctgggcaagccggtgctg
atggggcgcaagaccgcgcagtcgctgggccgcgcgctgccggggcgcctgaatctggtg
ctgacgcgctcggggcaggtgccgttcgaaggcatgcaggcggtcgcttcgctgtccgcc
gcgatcgaggcggcgcaggccagcggcgccggggagctggcggtgatcggcggtggcgac
atcttcgcgctggccttgccgcatgccgagatgctgtacctgacccacgtggacacgctg
gtcgaaggcgccgatgcgcattttccggcgttcgatccggcgcagtgggaggtcgtggcg
cggcaggcgcacgcggccgatgcccggcatgcgctggcgttcgaattcgtcgattaccgg
cgcaggcgtagcgcgccgtag

DBGET integrated database retrieval system