KEGG   Xanthomonas translucens: FD63_05965Help
Entry
FD63_05965        CDS       T03961                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xtn  Xanthomonas translucens
Pathway
xtn00071  Fatty acid degradation
xtn00072  Synthesis and degradation of ketone bodies
xtn00280  Valine, leucine and isoleucine degradation
xtn00310  Lysine degradation
xtn00362  Benzoate degradation
xtn00380  Tryptophan metabolism
xtn00620  Pyruvate metabolism
xtn00630  Glyoxylate and dicarboxylate metabolism
xtn00640  Propanoate metabolism
xtn00650  Butanoate metabolism
xtn00900  Terpenoid backbone biosynthesis
xtn01100  Metabolic pathways
xtn01110  Biosynthesis of secondary metabolites
xtn01120  Microbial metabolism in diverse environments
xtn01130  Biosynthesis of antibiotics
xtn01200  Carbon metabolism
xtn01212  Fatty acid metabolism
xtn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xtn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FD63_05965
   00630 Glyoxylate and dicarboxylate metabolism
    FD63_05965
   00640 Propanoate metabolism
    FD63_05965
   00650 Butanoate metabolism
    FD63_05965
  Lipid metabolism
   00071 Fatty acid degradation
    FD63_05965
   00072 Synthesis and degradation of ketone bodies
    FD63_05965
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FD63_05965
   00310 Lysine degradation
    FD63_05965
   00380 Tryptophan metabolism
    FD63_05965
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FD63_05965
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FD63_05965
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FD63_05965
Enzymes [BR:xtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FD63_05965
Exosome [BR:xtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FD63_05965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKK67058
UniProt: A0A0G3LMY9
Position
complement(1339837..1341012)
Genome map
AA seq 391 aa AA seqDB search
MTEIVIAAAKRTAIGAFLGQFNGVPTPELGAAAIRAALEQSGIPAADVSEVIMGCVLPAN
LGQAPARQAARAAGVPDATGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNHDDGQAMGVFGEATAEKFGFSRQDQDAYAI
ESVTRAQAAQRDGAFDAEIVPVRVVTRKGEAVFASDEQPGKSDIAKIPALKPAFKKDGTV
TAASSSSISDGAAATVLLSAADAARRGVVPLARIAGHATFSQAPEWFTTAPVGAIRKLLE
QVGWSLDQVDLFEINEAFAVVPMVPIKELGLDPAKVNVNGGACALGHPIGASGARLVVTL
LNALRMRGGRRGIATLCIGGGEATAVAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgtgatcgccgcggccaagcgcaccgccatcggcgctttcctgggccag
ttcaacggcgtgcccacgccggaactcggcgccgcggccatccgcgctgcgctggagcag
tccggcatccccgccgccgacgtgtcggaggtgatcatgggctgcgtgctgccggccaac
ctcggccaggccccggcgcgccaggccgcgcgcgcggccggcgtgcccgacgccaccggc
gccaccacgatcaacaaggtctgcggctcgggcatgaaggcgatcatgctcggccacgat
ctgatcaaggccggctcggccagcatcgtcgtcgccggcggcatggaatcgatgagcaac
gccccgcacctgctgccgaattcgcgcaccggcaaccgctacggcaacttccaggcggtc
gatcacatggcctgggacggcctgaccaaccacgacgacggccaggccatgggcgtgttc
ggcgaggccaccgcggagaagttcggtttcagccgccaggaccaggacgcctacgcgatc
gaatcggtgacgcgcgcgcaggccgcgcagcgcgatggcgccttcgatgccgagatcgtg
ccggtgcgcgtggtcacccgcaagggcgaggcggtgttcgccagcgacgagcagccgggc
aagtccgacatcgccaagatccccgcgctgaaaccggcgttcaagaaggacggcacggtc
actgccgccagttcctccagcatctcagacggcgccgccgccacggtgctgctcagcgcc
gccgacgccgcccgccgcggcgtggtgccgctggcgcggatcgccggccacgcgaccttc
tcgcaggcgccggaatggttcaccacggccccggtcggcgcgatcaggaagctgctcgag
caggtcggctggagcctggaccaggtcgacctgttcgagatcaacgaagcgttcgcggtg
gtgccgatggtgccgatcaaggaactggggctggacccggccaaggtcaacgtcaacggc
ggcgcctgcgcgctcggccatccgatcggcgcatccggcgcgcggctggtggtgacattg
ctaaacgcgttgcgcatgcgcggcggacgccgcggaatcgccaccctgtgcatcggtggc
ggcgaggcgacagcggtcgccatcgaattgatttga

DBGET integrated database retrieval system