KEGG   Xenopus tropicalis (western clawed frog): 100036603
Entry
100036603         CDS       T01011                                 

Symbol
dhh
Name
(RefSeq) desert hedgehog protein precursor
  KO
K11990  desert hedgehog
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100036603 (dhh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xtr01002]
    100036603 (dhh)
Peptidases and inhibitors [BR:xtr01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100036603 (dhh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint Hom_end_hint Hint_2 DUF2100
Other DBs
NCBI-GeneID: 100036603
NCBI-ProteinID: NP_001090638
Xenbase: XB-GENE-483465
UniProt: A0JM37
Position
2
AA seq 396 aa
MPAVRILTLAVCCWLLLVPVCCCGPGRGPVGRRRYMRKLVPLRYKQFVPNVPEKTLGASG
KSEGKIRRGSERFIELVPNYNPDIIFKDEENTGADRLMTERCKDRVNALAISVMNMWPGV
KLRVTEGWDEDGHHAHDSLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHVSVKADNSLGVRSGGCFPGTAMVMMASGEKKSLSELQLGDTVFTTDETGQLIPSVVLL
FLHRDLYKTATFVLIEAEGHTSKLLVTPNHLLFIKRSLSAGFLPTFAYRVQIGDLVQIYV
NGTQLQPSKVVRVSVEEQTGVYAPMTEHGTLLVDGVLTSCYATVESHTLAHASLAPLRLF
KGIASMLPDLDLSDGVHWYCHILYLLAKYVLWWDMP
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgccagcagtccggatactgacgctggctgtctgctgctggctcctcctggtcccagtt
tgctgttgtggtcctggccgggggccggttggccgtcgccgttacatgcgtaagctggtc
ccactgcgttacaagcagtttgtgcctaatgttccagagaagacactaggggccagtggc
aagtcagagggcaagatccgacggggctcagaaaggtttattgagttggttcccaactac
aacccagacatcatcttcaaggatgaggagaacacaggagctgaccgactcatgactgag
cgctgtaaagacagagtcaatgccttggctatctctgtgatgaacatgtggccaggcgtg
aagctccgggttaccgagggctgggacgaggatggacaccatgctcatgactctctgcat
tatgaagggcgcgcattggacattacaacatctgaccgagacaggagcaaatatggcatg
ttggcacgcctggcagtggaagctggctttgactgggtgtattatgaatccaaagcacac
atccatgtctctgtgaaagcagataactcactgggtgtccgatctggtggctgttttcct
ggaacagctatggttatgatggcgagcggtgagaaaaagtctctgtctgaactgcagctt
ggcgacactgtcttcactacagatgaaacaggccagttgatcccttcagtggttctgctc
ttcttgcacagggatctatataaaacagctacgtttgtgctgattgaagctgaggggcac
acatccaagctccttgttacacccaatcatttgttgtttataaaaagaagcttatcagca
ggatttctaccaacttttgcttacagagttcagataggagacctggttcaaatctatgtg
aatggcactcagctgcaaccttctaaggttgtgagggtatctgtagaggaacaaactggt
gtatatgcccccatgacagaacatggaaccttacttgtggatggggtgctaacatcctgc
tatgctactgtggagtcacacactctggcacatgcatctttggccccacttagactcttt
aaaggcatagcttcaatgctcccagatttagacctgagtgacggggtgcactggtattgt
cacatactctatctgctggccaagtatgttctttggtgggatatgccttaa

DBGET integrated database retrieval system