KEGG   Xenopus tropicalis (western clawed frog): 100036654
Entry
100036654         CDS       T01011                                 

Gene name
igsf3
Definition
(RefSeq) immunoglobulin superfamily member 3 precursor
  KO
K06522  immunoglobulin superfamily, member 2/3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100036654 (igsf3)
   04090 CD molecules [BR:xtr04090]
    100036654 (igsf3)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100036654 (igsf3)
CD molecules [BR:xtr04090]
 Proteins
  100036654 (igsf3)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 Ig_6
Other DBs
NCBI-GeneID: 100036654
NCBI-ProteinID: NP_001090681
UniProt: A0JPB1
AA seq 1161 aa
MGTAALLILLAGVSWAQREVAIQPGPLYRAEGSQISIWCNVRGYQGPSEQNFLWSIYLPT
APEKEIQIVGTNDPSFSYAIYSQRVRSGGIYVERVSGDRALLHIRQLQDQDTGEYECHTP
NTDPSYHGSYSAKVNLQVIPDTLTVSSPAQTIQKVEGGSLQVTCEVSQNSSRHTHLSVSW
LRLSEGEATEIISVTQNFSVRPGPSYAQKHSVGDVRLDKVGDSTFRLTLYNLHPSDQGDI
YCEGTEWIQDPDGTWFPLTQKRSEGTSVTVLPTDKEFNVRLETERRTYNGGDTATLRCII
EAQNPGDRLFAVSWAFNSSLIASQSPGGVPSLTGEYARREDGGELRVGKDSDSVFSLKIF
RLRPEDSGKYNCRVTERERGPSGELIDRESKRPKNIPISVLPLRTSLTVTVTANSSSVLE
GVRLSLSCSVASLAGPQSRVSASWHLQDKQGRQRDVVRQDRDGVTWAGEQYRERLGTGGL
RLLRSGSDTFSLELEGSQRTDAGSYECRVAEWVPAPDGEWQLLGERSAQANVDILALETG
FAVTAITRTPGVTYFDSFDLQCILKPHYPPWVGVSVTWRFQPAGGGDTHDLVTFSRSGGV
QWGERAGSFRGRSIVEKGDSTHTVRLSVSRASDSEAGKYQCVAELWRRETSGMWARLAER
ASNLLEIRVQRPVPRLQVTKVTRTLSVVEGSPVTLSCSIRSQSGPDSRFAVLWLVQQPSG
AEGKLIGRSDAGTEFGTYPEGALLKGRLQLGVTAPGQYALTLQGARTDDSGSYYCQVEEW
AMDPNQAWYRLAEETSGLTEIRVRPPDANLQLDQLPRNVSALEGQSVTVTCHVLNRTLPD
SRLSLEWLCWRAGHMERRGLARLTVDGVLGSVEEEPGDVAPGLPSRVQVSQPSLGLYALT
LRGTEVRDSGTYSCLVQEWLRDPRGQWYRRTEERSGATYVSVRQPDPQLQLDPSLLNVSV
MEGGHFDLDCMVSSRSRPDSQLAISWSLQGTSRGAEPETLLNVDRSGVWAPLAPRWEGRL
QQLQLSPTLFRLHVPRVGPGDSGNYTCLVQEWLLGPRGDWYLLAQDEAVIGWIRVQRKES
NLQSTICANDALFYLVFFYPFPIFGILIITILLVRFRHRPTGKPGEGKNGVPLLWIKEPH
LNYSPTCLEPPVLSIHPGTID
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgggcacggctgccttactgatcctcctggcaggtgtgagctgggcccagcgggaagtg
gccatacagccggggcccctctaccgggcagaaggctctcagatcagtatctggtgcaat
gtgcgtggctaccaggggccctcggagcagaacttcctgtggtccatatacctgcccacc
gcccctgagaaggagatccagatagtcggaaccaatgacccttccttctcctacgccatc
tactcacagcgagtgcgctccgggggcatctacgtggagcgagtgagcggggaccgggcc
ctcttacatatccgccaactgcaggaccaggacacgggcgagtacgaatgccacaccccc
aacactgacccctcctatcatggcagctacagcgccaaggtcaacctgcaagtgattccg
gacactctgacggtctcgtccccggcacagacgatccaaaaggtggagggggggtctctg
caggtgacctgtgaagtttcccagaattcctcccggcacacccacctgtcagtctcctgg
ctccgactgtctgagggggaggcgaccgagatcatctctgtgacccagaacttctctgtg
cggcccggtccctcctacgcccagaagcactcggtgggggacgtcaggctggacaaagtg
ggcgacagcaccttccgcctgaccctgtataacctgcaccccagcgaccagggcgacatt
tactgcgagggcacggaatggatccaggatccggatgggacttggttccccctgacccag
aaacgctcagaagggacgtcagtgacggtactgccaacagacaaggaattcaacgttcgc
ttggagacagagcgtcggacgtacaatggcggcgacacggcgactctccggtgcatcatt
gaggcgcagaacccgggggatcgcttattcgcggtgtcgtgggcatttaacagctccctg
attgccagccagagccccgggggggtcccatccctgacgggggagtatgccaggcgggag
gatggcggggagctgcgggtgggcaaggacagcgacagcgtcttctcactcaagatattt
cgccttcgccccgaggacagcgggaaatacaactgccgggtaacggagcgcgagcggggc
ccctccggggaactcatcgaccgggagagcaagaggcccaagaacatccccatctctgta
ctgcccctgaggacgtctctgacagtcacggtgacagccaactccagctcggtgctagag
ggggtgcgcctgtctctcagctgctcggtggcatctctcgccggaccccagagccgcgtg
tcggcctcctggcacctacaggacaaacaggggcgccagagggacgtggtgcggcaggac
cgggatggagtaacgtgggccggggagcagtaccgggagaggctgggcaccggggggctg
cggctgctccggtccggctcggatacgttcagcctggagctggagggcagccagagaacg
gacgcgggttcctacgagtgccgggtagcggagtgggtaccggcccctgacggagagtgg
cagctgctgggcgagagatcagctcaggccaacgtggatatcctggcactggagaccgga
ttcgccgtgacagcaatcacccgcacgcccggcgtaacctacttcgactcattcgacctg
cagtgcatcctgaagccccactatcccccctgggtgggggtgtcggtcacctggcgcttt
cagcccgcggggggcggagacacgcacgacctggtgaccttcagtcgctccggcggggtc
caatggggggaaagggccggaagtttccgtggccggagtattgtggagaagggagactcc
actcacactgtgaggctgagtgtgagtcgggccagtgattcggaggcgggcaagtaccag
tgtgtggccgagctatggaggcgggaaaccagcggcatgtgggcgcggctagctgagagg
gcatccaacctgctggagatcagagtccagcgcccagtgccgcggctgcaggtcactaag
gtgacgaggaccctcagtgtagtggaggggtctccggtgacgctgagctgctccattcgc
tcccagagtgggccggactcgcgctttgccgtgctgtggttggtgcagcagccctcgggg
gcggaagggaagctgattgggcgcagtgacgcgggcacagagtttggcacctaccccgag
ggggcgttgctgaaagggcggctgcagttgggggtcacggcaccagggcaatacgctctc
accctgcagggggcacgtaccgacgacagtggcagctactactgtcaggtggaggagtgg
gcaatggaccccaaccaggcctggtaccgattggctgaggagacgtcggggctgactgag
atccgtgtgagaccaccagatgccaacttgcagctggatcagttgccccggaacgtatcg
gccctggaggggcagagtgtgaccgttacctgccacgtgctgaaccggaccctccccgac
tcccgcctgtccctggagtggctgtgctggcgggcggggcatatggagaggcggggcctg
gccaggctgacggtggatggggtactgggctcagtagaggaggagccgggcgatgtggcc
ccggggctgcccagtcgcgtgcaggtatctcagccgtccctcgggctctatgccctcacc
ctgcgtggcaccgaggtgcgggacagtggcacctacagctgcctggtacaggagtggctc
cgggacccgcgggggcagtggtacaggcgcactgaggagcgatcgggggccacttatgtg
agtgtgcgccaaccggacccgcagctgcagttggacccctctctgctcaacgtgtcggtg
atggagggcggccattttgatctggactgcatggtatcgtcgcgctcgcggccggactcc
cagctcgccatttcctggtccctacaaggcacatcccggggggcggagccggagacgctg
ctgaatgtggaccgttccggggtttgggccccgctggcgccgcggtgggaggggcgctta
cagcagcttcagttgtcgcctactctgttccgccttcacgtgccgcgcgtcggcccaggg
gattctgggaattacacctgcctggtacaggagtggctgctgggacctcggggcgactgg
tacctcctggcccaggatgaagctgtgattggttggatcagagtgcagagaaaggagtcc
aacctgcagtcgaccatctgtgccaacgatgccctcttctacctggtcttcttctacccc
ttccccatcttcggcatcctcatcatcaccatcctgttggtgcgcttccgccaccggccc
acgggcaagcctggcgagggcaagaacggggtccccctgctgtggataaaggagccccat
ctcaactactccccaacgtgcctggagccccccgtgctcagcattcacccgggcaccata
gactaa

DBGET integrated database retrieval system