KEGG   Xenopus tropicalis (western clawed frog): 100036662Help
Entry
100036662         CDS       T01011                                 

Gene name
paics.2, ade2, airc, paics, pais
Definition
(RefSeq) phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase, gene 2
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr01100  Metabolic pathways
Module
xtr_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100036662 (paics.2)
Enzymes [BR:xtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100036662 (paics.2)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100036662 (paics.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRC SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 100036662
NCBI-ProteinID: NP_001090685
Xenbase: XB-GENE-5872994
UniProt: A0JPD0
Position
1
AA seq 249 aa AA seqDB search
MIPIEWFCRRIASKRNAETEEGYRFPQAKVEMYKVNDTNNHQVSVEQLIAVKLICSGILI
GKIEVDVMTRSTIAIFEIIEKSWRAQDCTLVDMRIKFGVDVTKKEVLLTDIKCGSQALWP
AGNKSQLKNNLCLDGQSRVVVLMASTSDLVHCEEIKKSCSKYGMKCELRVASAHTGPQET
LEIIAEYEGDYIPTVFIAVAGGSNGLGAIVAANSSHPVINCPPLSEDWSTKDIWSSLRVP
SGKKHSVMM
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattccaatagagtggttctgtcggagaattgccagtaagaggaatgcagagactgaa
gaaggctacagatttccccaagcaaaagtagagatgtataaggtgaatgatactaataat
caccaagtctcggtggaacagttgatagcagtaaagcttatctgttcaggaattctgatt
ggaaagattgaggtggatgtaatgactcgctccacaatagccatatttgaaattatagaa
aaatcatggcgggctcaggactgcactttggtggacatgaggattaagtttggtgttgat
gtgactaaaaaagaagttctacttactgatattaaatgtggctctcaagctctttggcca
gcaggaaacaagagtcagctgaaaaataatttgtgcttagatggccagagcagagttgtc
gtgttaatggcatcaacttcggatcttgtgcactgtgaagaaatcaagaagtcgtgttcc
aagtatggaatgaaatgtgagctgagggtggcttcggcccacacaggcccacaggaaact
ctggagatcatagcagaatatgaaggagattacattccaactgttttcatagcagtggct
ggtggaagcaatggcttaggggctatagtggctgcaaattcttctcatcctgttattaac
tgcccccctcttagcgaagattggagcactaaggatatctggtcttctctcagggtgcca
agtggtaagaaacatagtgttatgatgtaa

DBGET integrated database retrieval system