KEGG   Xenopus tropicalis (western clawed frog): 100038188
Entry
100038188         CDS       T01011                                 

Gene name
apln
Definition
(RefSeq) apelin preproprotein
  KO
K05225  apelin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
xtr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100038188 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100038188 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 100038188
NCBI-ProteinID: NP_001165146
Xenbase: XB-GENE-478202
UniProt: A9ULR5
Position
8
AA seq 76 aa
MNLRLWALALLLFILTLTSAFGAPLAEGSDRNDEEQNIRTLVNPKMVRNPAPQRQANWRK
IRRQRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatctcagactttgggcactggcgcttctgctcttcattttaaccttgacttcagca
tttggagctccactggctgaaggctcagatagaaatgatgaagaacagaatatccggaca
ctggtaaacccaaaaatggtccgtaaccctgcacctcaacggcaagccaactggagaaaa
atccgacgtcaaagacctcgcctttcacacaagggcccaatgcccttctaa

DBGET integrated database retrieval system