KEGG   Xenopus tropicalis (western clawed frog): 100038256Help
Entry
100038256         CDS       T01011                                 

Gene name
tfip11, STIP, STIP-1
Definition
(RefSeq) tuftelin interacting protein 11
  KO
K13103  tuftelin-interacting protein 11
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    100038256 (tfip11)
Spliceosome [BR:xtr03041]
 Complex C
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-SnRNP related factors
    100038256 (tfip11)
  Other components
   Complex C specific factors
    100038256 (tfip11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCFC TIP_N G-patch CENP-K G-patch_2 CENP-Q
Motif
Other DBs
NCBI-GeneID: 100038256
NCBI-ProteinID: NP_001090845
Xenbase: XB-GENE-984521
UniProt: Q0IIX9
Position
4
AA seq 825 aa AA seqDB search
MSMSHLYGKDEDSDGVEMENFEITDWDLQNEFNPNRRKHFQTKEEATYGMWAERDSDDER
PSFGGKRSRDYSAPVNFISAGIRKPAAEEKSDSDSDSETQARRETFPKDFEAKKLRTGGN
FKPSQRTFAGGIKSNTDFGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQR
KGKGAVGAYGSERTKQSIKDFPVVDSEEEEEKEFQKEMSQWRKDPGGGKKKPKYSYKTVE
ELKAKGKVGKSLSAPQKEISQVKVIDMTGREQKVYYSYSQLAHKHNIPGEAPGQGAKEEK
PQGFALPELEHNLQLLIDMTEQEIIQNDRQLQYEQDMVVNLTHELEKLSEVLEREEQAIQ
NLSKVLETVEECERRIQPMCDNPLTLEECARIFEMLQDKYYEEYKMSEKADLSVAIVYPL
MKDYFKDWNPLRDPTYGTDVMSKWKNLLEEGHLLSHSAHDASMDPYHRLLWETWVPLLRS
IIAQWQPRNCAPMVDFLDCWVHLLPVWILDNILDQLIFPKLQKEVENWNPLTDTVPIHSW
IHPWLPLMQSRLEPLFSPIRNKLANALQKWHPSDSSAKLILQPWKEVFTPGSWEAFMVKN
ILPKLGMCLSEFVINPHQQHMEVFHWVTDWEGMVSLSSIVGILEKHFFPKWLQVLCSWLS
NTPNYEEITKWYLGWKSMFSDLVLAHPAIKDKFNEALDIMNRAVSSSVGAYMQPGARESI
AYLTQTERRKDFQYEAMQERRDAESIAQRGIGAAAAVPMNFKDLIQSKAEEHNIVFMPLI
GKRHEGKQLYNFNRIVIYIDRGVVFVQGEKTWVPTSLQSLIDMAK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgtcgcacctttatggcaaagatgaggacagcgatggagtggaaatggagaac
tttgagatcacggactgggacctacagaatgagtttaaccccaaccgcagaaagcatttc
caaacaaaagaggaggcgacctatgggatgtgggcagagcgggactctgatgatgagagg
ccaagctttggggggaaaaggtctcgagactactcggcccctgtcaattttatcagcgct
gggatccgtaagccagctgcagaagaaaaatctgatagtgattccgacagtgaaacgcaa
gcaaggagggaaactttcccaaaggattttgaggcaaagaagctaaggacgggtggtaat
ttcaaaccatcacagaggacatttgctggaggaataaagtcaaacacagattttggttct
tgggagcggcataccaagggaatcggccagaaacttcttcagaagatgggttatgtgcaa
ggaagaggcctaggaaagaatgctcaaggtatcattgcccccattgaagccaaacaaagg
aaaggtaaaggagcagtaggggcgtatggctcagaaaggaccaagcaatcgattaaggat
ttccctgttgtggattctgaagaagaagaggaaaaggaatttcagaaggagatgagccaa
tggcgtaaggaccctggcggagggaagaaaaaacctaaatactcatacaaaacagtagag
gagctgaaagccaaaggcaaagtgggaaagtctctgtctgcaccccaaaaagaaatatcc
caagtaaaggtgattgatatgactggtcgggagcagaaggtgtactatagttacagtcag
cttgcccacaagcacaacatcccgggagaggcgcctggtcagggggcaaaggaggagaaa
cctcagggctttgctttgccagagctggaacacaacttacagctgctaattgatatgaca
gagcaagaaatcattcagaatgaccgtcagctgcagtacgaacaggacatggtggtgaat
ctcacccatgagctggagaagctttcggaggtgctggaacgggaggaacaagccatacag
aacctaagtaaggttctagagactgtagaggagtgcgaacggaggatccagcctatgtgt
gataaccctctgacgctggaggagtgtgcgcgcatattcgagatgttgcaagacaagtac
tatgaggagtacaagatgtctgagaaggcagacctttctgtggccattgtctacccactg
atgaaagattatttcaaagactggaacccacttagggatcctacttatgggactgatgtc
atgagtaagtggaagaaccttctagaggaaggtcacctcctatctcacagtgcacatgat
gcatctatggacccataccacagattgctgtgggagacgtgggttcccctgttaaggagt
atcattgcccaatggcagcccagaaactgcgctcccatggtggactttttagactgctgg
gtccatttgctgccagtctggatcctggataacatactagatcagcttattttccccaaa
ttacaaaaagaggttgagaactggaaccccctgacagacaccgtcccaatccactcgtgg
attcacccctggcttcctttgatgcagtcgcggctagagccactcttctctcccattcgg
aataaacttgccaacgccctccagaaatggcaccccagcgattcctctgccaagctgatc
ctgcagccctggaaggaggtgtttacgccaggctcttgggaagccttcatggtgaagaac
attttgccaaagctaggcatgtgtctcagtgagtttgttattaatccgcaccaacagcac
atggaagtcttccactgggtcactgactgggaggggatggtctctttgtccagcatcgta
gggatcctggagaaacatttcttccccaagtggctgcaggttctgtgctcctggctcagt
aatacccccaattatgaagagatcaccaagtggtatctcggctggaagtccatgttctca
gacctggtgttggctcacccggccatcaaggacaaatttaatgaggctctggatatcatg
aaccgagctgtgtcctctagtgttggtgcctacatgcagccgggggcacgggagagcatc
gcctacctcacgcagaccgagagaaggaaggacttccagtacgaggctatgcaggagcgg
cgagacgcggagagcattgctcagagaggaataggggctgcagcggctgtgcccatgaac
ttcaaggacctgatccagtccaaggccgaggagcacaacatcgtatttatgcctctaatt
ggcaagcgtcacgaggggaaacaactttacaacttcaaccgcatagtgatctatatagac
agaggcgttgtgttcgtacagggagagaaaacatgggtgcccacctccctgcagagcctt
attgacatggccaagtag

DBGET integrated database retrieval system