KEGG   Xenopus tropicalis (western clawed frog): 100038268
Entry
100038268         CDS       T01011                                 

Gene name
prkcq
Definition
(RefSeq) protein kinase C theta type
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04140  Autophagy - animal
xtr04270  Vascular smooth muscle contraction
xtr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100038268 (prkcq)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100038268 (prkcq)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100038268 (prkcq)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100038268 (prkcq)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100038268 (prkcq)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100038268 (prkcq)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 Kinase-like PHD zf-RING-like Zf_RING Pkinase_fungal DUF3621 zf-RING_9 DZR
Other DBs
NCBI-GeneID: 100038268
NCBI-ProteinID: NP_001090855
Xenbase: XB-GENE-487643
UniProt: A4IGL9
Position
3
AA seq 554 aa
MKQAKVHQVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAK
CTGSAVNSKETVLHKERFKIDMPHRFKVNNYRSPTFCEHCGTLLWGLARQGLKCAECNMN
VHHKCAVKVANLCGVNQKLMAEALAMIETTQQDRRQRDSEFIYREGPVNVGPTTNTQDQP
IVLSIKKESQGISWESPIESIKVQESPPEPELKIEQSSCQIKVTFSNFVLHKMLGKGSFG
KVFLAELKGTNQFFAIKVLKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHLYCTFQTKE
HLFFVMEYLNGGDLMFHIQSCHKFDLPRATFYAAEIVCGLQFLHSKGVVYRDLKLDNILL
DMEGHIKIADFGMCKESMLGDAKTSTFCGTPDYIAPEILLGQKYNYSVDWWSFGVLLYEM
LIGQSPFHGIDEEELFQSIRMDNPMYPRFLSMEAKDILIMLFVREPERRLGVKGDIRQHC
FFQHIDWGRLENREIEPPFKPKVKSADDWSNFDKEFLNEKPRLSSSERTLINSMDQNMFN
NFSFVNPKMEAIVS
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaaacaggccaaagttcaccaagtcaagtgccatgaatttacagccactttcttccct
caaccaactttttgctcagtttgccatgaatttgtttgggggcttaacaagcaaggatac
caatgcagacagtgtaatgcagcaatccacaagaaatgcattgataaagtcattgctaaa
tgcacggggtctgcagtcaacagtaaagaaacagtgcttcacaaagaaagatttaaaatt
gacatgccacacagattcaaagtcaataattacagaagtcctactttctgtgaacactgc
gggacactgctgtggggtcttgcacgtcagggattaaagtgcgctgagtgcaatatgaat
gttcaccacaaatgtgccgtgaaagttgcaaatctctgtggggttaaccagaagttaatg
gcagaagctctggcaatgatagagactacccaacaggacagaagacagcgcgattcagaa
tttatttacagggaagggcctgttaatgttggtcccacaaccaatacacaagaccagcct
atagtattatctataaagaaagaatcacaaggtatttcttgggaatcgccaattgaaagt
ataaaagtccaagagtcacctccagagccagaactgaaaattgaacagtcaagctgtcag
attaaagtgaccttctcaaacttcgttcttcataaaatgctggggaaagggagctttgga
aaggtatttctcgctgaactaaaagggacaaatcagttttttgccataaaagtcctgaag
aaggatgtggttcttatggatgatgatgttgagtgcactatggtggagaaaagggttctt
tcacttgcatgggagcatccattcctcacccatctttactgtacattccaaacaaaggag
catctgttctttgtcatggagtaccttaatggcggagatcttatgttccatatacaaagt
tgccataaatttgatcttcccagagccaccttctatgctgctgaaatcgtgtgcggtctt
cagtttcttcattctaaaggagtggtgtacagagacctgaagctagataacatactcttg
gacatggaaggacacataaaaatagcagattttggaatgtgcaaggaatccatgttggga
gatgcaaaaacaagcactttttgtggtactccagattatattgcccctgagattttgctt
ggacaaaaatacaactattcagtcgactggtggtcatttggagtccttctgtatgaaatg
ttaattggccagtcaccatttcatggcatagacgaagaagaattgtttcagtctattcgc
atggacaacccgatgtaccctcgctttctcagtatggaagctaaagatattttaatcatg
ctctttgtgagagaacctgaaagaaggcttggagtaaaaggagatattcgtcagcattgc
ttcttccagcacattgattggggacgactggaaaacagagaaattgagccaccatttaaa
cctaaagtgaaatctgcagatgattggagcaattttgacaaggagttcttaaatgaaaaa
cccagattatcaagttcagaaagaacgttaataaacagcatggatcaaaatatgttcaat
aatttttcatttgtaaatcccaaaatggaagcaattgtatcctga

DBGET integrated database retrieval system