KEGG   Xenopus tropicalis (western clawed frog): 100124739
Entry
100124739         CDS       T01011                                 

Gene name
adarb1
Definition
(RefSeq) double-stranded RNA-specific editase 1
  KO
K13194  double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    100124739 (adarb1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-  Acting on carbon-nitrogen bonds, other than peptide bonds
    3.5.-.-  
     100124739 (adarb1)
Spliceosome [BR:xtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    100124739 (adarb1)
SSDB
Motif
Pfam: A_deamin dsrm
Other DBs
NCBI-GeneID: 100124739
NCBI-ProteinID: NP_001096190
Xenbase: XB-GENE-954085
UniProt: A4IIV9
Position
9
AA seq 719 aa
MKTHFELSAIRHSRNQQKYFTMDVDDDENLSSSSADVKENRMDGASAKEGSGQATGDGAQ
LSNGSEGSNSRKRPLEEGNNGHSKFRPKKRKKIPGPVLPKNALMQLNEIKPGLQYKLISQ
TGPVHAPVFIMTVEVNGQVFEGSGPTKKKAKLNAAEKALRSFVQFPNASEAHLAMGRTLS
VNTDFTSDQADFPDTLFNGFEKPEQSEHVFFLGSNGNESFNSANDYSLSMIGSSNFIQSP
LPTPSLFPPASGKNPVMILNELRPGLKYDFVSESGESHAKNFVMSVTVDNETFEGSGRNK
KLAKARAAQSALASLFNMHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVVDKFSDLTDN
FTSPHARRKVLAGVVMTTGTDVKDAQVICVSTGTKCINGEYMSDRGLALNDCHAEIISRR
SLVRFLYTQLELFLSTKEDQQRSIFMKSERGGFKLKDNVQFHLYISTSPCGDARIFSPHE
AGQEDQGDRHPNRKARGQLRTKIESGEGTIPVRSSSTIQTWDGVLQGERLLTMSCSDKLA
RWNVVGIQGSLLSLFVEPIYLSSIILGSLYHGDHLSRAVYQRISDIEDLPHLYALNKPLL
SGISNAEARQPGKAPSFSVNWAVGDSGLEVINATTGKDEMGRASRLCKHALYSRWMRIHA
KLSSSVRCKIGKLNVYHDTKHSAVEYQSAKECVFKVFQKSGLGAWVKKPIEQDQFSLNV
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaaaacacatttcgagttgagcgctatccgccattcaagaaaccagcaaaagtatttc
acaatggatgttgatgatgacgagaatctgagttcaagcagcgccgatgttaaggaaaat
cgcatggatggagcttcagcaaaagaaggaagtggccaagccaccggggatggggctcag
ctttccaatgggagtgagggaagcaacagcagaaaacggcctttagaagaaggcaacaat
ggccattccaagttccgtcctaagaagaggaagaaaattccaggccctgtgttgccaaaa
aatgctctaatgcaactgaatgaaattaagcctggcttacagtacaaacttatttctcag
acaggacctgtccatgcacctgtctttattatgactgttgaagtaaatgggcaagttttt
gaaggttcaggacctactaagaagaaggctaaacttaatgctgccgagaaggctttaagg
tcatttgtgcaattcccaaatgcatcagaagctcatctagcaatgggcagaactctgtct
gttaatactgattttacctctgaccaagcggactttccagatactctgtttaatggattt
gaaaaaccagaacagtccgagcatgtttttttcttgggctctaatggaaatgaatccttt
aattctgcaaatgactatagcttatcgatgattggaagcagtaattttattcagtctccc
cttccaacaccatctttgttcccaccagctagtggaaaaaatcctgtaatgattttaaat
gagcttcgtcctggccttaaatacgactttgtctcagagagtggtgaaagtcatgccaag
aactttgtgatgtctgtaactgtagacaatgaaacatttgaaggatctggaaggaacaag
aagcttgcaaaggcgagagcagcacagtctgcccttgcatcgctttttaacatgcacttg
gatcagaccccatccagacagcctattccaagtgaaggcctacaattacatttaccccag
gttctggctgatgctgtttcccgcttggttgtggacaaattcagtgacttgactgataat
tttacatcaccacatgcacgtcgtaaagttcttgctggagttgtcatgacaacaggaaca
gatgttaaagatgcccaagtcatatgtgtttccactggaactaagtgtattaacggggag
tacatgagtgatcgaggccttgctctaaatgattgccatgctgaaattatatctcgcagg
tcgctagttcgatttctctacacacagcttgagctgtttttaagcaccaaggaagaccag
caaaggtctatatttatgaagtcggaacgtggaggatttaagcttaaggataatgttcag
tttcatctgtatattagtacatcgccctgtggagacgctcgtattttctcaccccatgaa
gctgggcaggaagaccaaggagatcggcatcctaaccggaaagcaagagggcagcttcgt
accaaaatagaatctggagaaggcaccataccagttcgatcaagcagtaccatccagaca
tgggatggggttttacaaggagagagattgcttacaatgtcctgcagtgacaagttagca
aggtggaatgttgtaggaatccagggatccctgctcagtctgtttgttgaaccaatttac
ctgtcaagtattatcttgggtagcctatatcatggtgaccacctgtcaagggctgtctac
cagcggatatcggatatagaagatttaccccatctttatgcactcaataaacccttatta
agtggaataagcaatgctgaagcacgacagcctggcaaagcccccagcttcagtgtgaac
tgggcagttggagactcaggccttgaagttattaatgctactacaggcaaagatgaaatg
gggcgtgcatcgcgcttatgcaagcatgctctgtacagccgatggatgagaattcatgct
aagttgtcttccagtgtgagatgtaaaatcgggaaacttaacgtttaccatgataccaaa
cattctgcggtagaataccagtctgcaaaagaatgtgtcttcaaagtctttcagaagtca
ggactgggagcctgggttaaaaaacccatagagcaggaccagttttctctaaatgtttaa

DBGET integrated database retrieval system