KEGG   Xenopus tropicalis (western clawed frog): 100124827
Entry
100124827         CDS       T01011                                 

Gene name
pde6g
Definition
(RefSeq) phosphodiesterase 6G
  KO
K13759  retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr01100  Metabolic pathways
xtr04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100124827 (pde6g)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100124827 (pde6g)
SSDB
Motif
Pfam: PDE6_gamma
Other DBs
NCBI-GeneID: 100124827
NCBI-ProteinID: NP_001165049
Xenbase: XB-GENE-945367
UniProt: A4IHC2
Position
10
AA seq 87 aa
MNLEPAKAEIKSATRVTGGPATPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGL
GTDITVICPWEAFNHLELHELAQYGII
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaatttggaaccagccaaggctgaaataaaatcagctactcgtgtgacagggggacct
gccacgcctaggaaaggacccccaaagtttaaacagcgccagaccaggcagtttaagagc
aaacctcccaaaaaaggggtgcaaggatttggagatgacatcccagggatggagggcctg
ggaacagatatcaccgttatttgcccttgggaagccttcaaccacttggagctgcacgag
ctggcccagtatggcattatctaa

DBGET integrated database retrieval system