KEGG   Xenopus tropicalis (western clawed frog): 100125025Help
Entry
100125025         CDS       T01011                                 

Gene name
foxo3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04068  FoxO signaling pathway
xtr04137  Mitophagy - animal
xtr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100125025 (foxo3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100125025 (foxo3)
  09143 Cell growth and death
   04218 Cellular senescence
    100125025 (foxo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    100125025 (foxo3)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100125025 (foxo3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 100125025
NCBI-ProteinID: NP_001096419
Xenbase: XB-GENE-945072
UniProt: A4IIM7 F7DZ24
Position
5
AA seq 653 aa AA seqDB search
MAEAVPSLSPPGDVDIDPDFEPQSRPRSCTWPLQRPDSQGSPGKPNSGAGEAGDASSMIP
EEEDDDDEGSGTTATMVGTAGEKGTVVLLSGGDLTVLASPVGGVETLQASLGGGGAGGAQ
SGATGQQQRKCSSRRNAWGNMSYADLITRAIESSQDKRLTLSQIYDWMVRSVPYFKDKGD
SNSSAGWKNSIRHNLSLHSRFIRVQNEGSGKSSWWMINPEGGKGGKAPRRRAVSMDNSNK
YTKSRGRAAKKKASLQASTDATDDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNAST
ISGRLSPIPATTELDDVQDDDSPLSPMLYSSPGSLSPSLSKPCTVEMPRITDMAGTMNLN
DGLPENLMDDLLDDISLTSSQQSSPGILMQRSSSFTYGTKGSGIGSPSNTFNNTSSFNFP
LTSLRQSPMQTIQENKQATFSSINHYSNQSLQDLLNTDTLSHSDVLMTQSDPLMSQASTA
VTAQNTRRNIILRNDPMMSFAAPSNQGGNLVNQNSLHQQQSLNSFQGGSRALSNNLSNTG
LNDSSNLDSTKHQQQSSVSHSMQTISDTLSGSLYSSAVNLPTLGHEKFPTDLDLDIFNGS
LECDMETIIRNDLMDADGLDFNFDTLISAQNVSLSVGSFTGAKQTSSQSWVPG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagccgtgccttccctctccccgcctggggacgtggacatagacccggacttc
gagccgcagagccgaccccggtcctgcacgtggcccctgcagagaccggactcccaaggc
agcccgggcaagccgaatagtggcgctggggaagccggagacgcgtcctctatgatcccg
gaggaggaggatgatgacgatgagggatctggtactacagccactatggtagggacagcg
ggggagaaggggactgtggtgctactgagcggaggagacctgaccgtgctggcgtcacct
gttggtggggtggaaacactgcaggcttcgcttgggggtgggggagcagggggcgcccag
agtggcgcaaccggacagcaacagaggaaatgttcatcccgcagaaatgcctggggcaac
atgtcctacgctgaccttatcactagggccatcgagagctcccaggataaacggctcacc
ctgtcccagatatatgattggatggtccgctcagtgccctacttcaaggataagggagac
agcaacagctctgcaggatggaagaattcaatccggcataatctgtcactacacagcagg
tttattagagttcagaatgagggctctggcaaaagctcttggtggatgatcaaccctgaa
ggaggaaaaggggggaaggcaccaagaagacgggctgtttcaatggacaatagcaacaaa
tacaccaagagccgtgggagagcagcaaagaaaaaagcgtctttgcaggcatctactgat
gctacagatgatagcccttcgcagctgtcaaagtggccaggtagtcccacctcacgtagt
agtgatgaacttgatgcctggacagattttcgatctcgtacaaactctaatgccagtacc
ataagtggtcgtttgtctccaattccagctacaactgaacttgatgatgttcaagatgat
gactctcccttgtcccctatgttgtatagcagcccaggtagtttgtccccatctttaagt
aaaccatgcacagtggagatgccaagaataacagatatggctggaaccatgaacttaaat
gatggattgccagagaacctcatggatgacttgctggatgacatttctctcacttcttca
cagcagtcatctcccggtatcctcatgcagagaagttccagctttacatatggcactaag
ggctcaggcattggctctccatctaatacttttaacaacactagtagcttcaactttccc
ttgacatcgctgcgccagtctcccatgcaaactatccaagagaacaagcaagctactttt
tcttccattaatcattacagtaaccagtctttgcaagacctgttgaatacagacaccctc
agccacagtgatgtgttaatgacccagtctgatccactcatgtcacaagccagtactgct
gtgactgctcagaataccagaagaaatataattctgagaaatgaccctatgatgtctttt
gcagccccatctaaccaaggaggaaatttggttaatcagaactcgctgcaccaacagcag
tctcttaactcttttcaaggtggcagccgtgccttgtcaaacaatttaagcaacactggt
ttaaatgatagcagcaacttggactcaaccaaacaccagcagcagtcctcagttagtcat
tctatgcaaaccatctcagacacgctctcaggatccttgtactcctcagccgtgaacctt
ccaacactggggcatgaaaagtttcccactgatttggacctggatattttcaatgggagt
ttggaatgtgacatggagacaataattcgcaacgatttaatggatgcagatgggttggat
tttaattttgacaccctcatctcagctcagaatgtcagtctatcggtgggcagtttcact
ggtgctaagcagacatcgtcacagagctgggtgccaggctga

DBGET integrated database retrieval system