KEGG   Xenopus tropicalis (western clawed frog): 100125152Help
Entry
100125152         CDS       T01011                                 

Gene name
tyr
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00350  Tyrosine metabolism
xtr01100  Metabolic pathways
xtr04916  Melanogenesis
Module
xtr_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100125152 (tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100125152 (tyr)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100125152 (tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase Laminin_EGF DUF1191
Motif
Other DBs
NCBI-GeneID: 100125152
NCBI-ProteinID: NP_001096518
Xenbase: XB-GENE-988578
UniProt: A4QNF6
Position
2
AA seq 531 aa AA seqDB search
MERNMVPLAFCCLFFFLHVCRGQFPRACSTAESLLSKECCPVWSGDGSSCGQLSGRGVCQ
DVVLTSSATGPQFPFTGVDDRENWPTVFYNRTCQCLGNFMGYNCADCKFGFRGPNCTERR
TMIRKEIFRMSSAEKSKFVAYLNLAKHTTSRDYVIVTGTYAQMNNGSNPMFADINVYDLF
VWMHYYASRDVFIGEDALWRDIDFAHEAPAFVPWHRYFLLHWEHEIQKLTGDENFTIPFW
DWRDAQGCDICTDELLGGVHPTTTSLLSPASFFASWQIVCSRPEEYNAQRILCNGTGEGP
LFRNPGGHDRSRTPRLPTTAEVELCLSLTNYETEPMDRSANFSFRNTLEGFADPRTGIAN
RSQSNMHNSLHVFLNGSMSSVQGSANDPVFVLHHAFVDSIFEQWLRRHGASVDIYPEANA
PIGHNRGYYMVPFIPLYTNGEFFAASRDLGYDYDYLAESGSIEDFLLPYLEQARQIWQWL
VGAAVVGGLITAVIATIVGLACRRKRKFPSEETQPLLMEAEDYQPTYQSHL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaacatggtccctctggcattctgctgcctgttcttcttcctccatgtttgc
aggggccagttcccaagggcatgtagcaccgcagagtcgctcctgagcaaggagtgttgc
cctgtgtggtctggagatgggtcctcttgtggccagctatcaggaaggggtgtctgccag
gatgttgtcctgaccagctctgctactggccctcagtttccattcactggggttgacgat
agagagaactggccaacagtattttacaacaggacgtgccaatgccttggcaacttcatg
ggctataactgtgcagactgcaaatttggcttcagagggccaaactgcacagagagaaga
acaatgataagaaaggagatattccgaatgagcagtgctgagaagagcaaattcgttgcc
tacttgaatttggctaagcacaccaccagccgtgactatgtcatagtcactggcacctac
gcccagatgaataatggctccaaccctatgtttgcggatatcaacgtgtatgacctcttt
gtctggatgcattactatgcctcccgtgatgtcttcataggagaagatgctctctggaga
gacattgactttgcccatgaagctccggcttttgtgccctggcacaggtacttcctgctg
cactgggaacatgagattcagaaactcacaggagatgagaattttaccatccctttctgg
gattggagagatgcccaaggttgtgacatatgtacggatgagcttctgggaggggtccat
cccaccaccaccagcctattaagcccggcatccttcttcgcttcatggcagatagtatgc
agccgccctgaggaatacaatgctcagaggatcctatgcaatggtaccggggaagggccc
ctgttcagaaatcctggtggccacgatcggagcagaaccccccgattgcctacaacagct
gaagttgagctgtgtctgtcattaacaaattacgaaacggagcccatggatcggtcggcc
aactttagcttcaggaacaccctagaaggatttgcagatccacgaactgggatagccaac
cgctctcaaagcaacatgcataactcgctgcatgtgttcctcaacggctccatgtcttcc
gtccaaggatcggccaatgacccagtttttgtcttgcaccatgcttttgtcgacagcatc
tttgagcaatggctcagaagacacggagcttcagtagacatttacccagaagccaatgca
ccaattggccacaatcgtggctactacatggttccatttattcctctatacacaaatgga
gaattctttgccgcttctagagatcttggatatgattacgattatctagcagaatcaggt
tccattgaagacttccttttgccctacctggagcaagcgcgacaaatctggcagtggctg
gtaggcgcggctgtagttgggggactcattactgctgtgattgccactattgtcggcttg
gcgtgccgacggaaaagaaaattcccatcggaggaaacgcagccgctgctcatggaagcc
gaagattatcaacccacctatcagtctcacctatag

DBGET integrated database retrieval system