KEGG   Xenopus tropicalis (western clawed frog): 100127203Help
Entry
100127203         CDS       T01011                                 

Gene name
mgll, hu-k5, mgl
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00561  Glycerolipid metabolism
xtr01100  Metabolic pathways
Module
xtr_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100127203 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xtr01002]
    100127203 (mgll)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100127203 (mgll)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S33
   100127203 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Lipase_3 Peptidase_S9 Esterase DLH Abhydrolase_2 Abhydrolase_5 AvrL567-A PGAP1 Thioesterase LIDHydrolase Abhydrolase_3 DUF2048 DUF2974 DUF2920
Motif
Other DBs
NCBI-GeneID: 100127203
NCBI-ProteinID: NP_001106390
Xenbase: XB-GENE-942085
UniProt: A8WGH9
Position
4
AA seq 309 aa AA seqDB search
MPEGSAPAVSPQGVLYAELTHYINADGQHIFSRYWKPSGSPRALMFIVHGAGEHCCRYDD
LAQILTALNFVVFSHDHVGHGQSEGERMTVPDFHIFVRDVIQHLDLMKKQYPGLPLFMCG
HSMGGAIAILTADERPDDFSGLILISPLVLPNPQSATSFKVFAAKMLNYVLPNLSLGSID
PNFVSRNKKEVEAYTSDPLVYHGGMKVSFGVQLLNATSRVEKALPHFKVPLLLFHGTLDK
LCDIRGSHVMMDTIQSEEKTLKVYEGAFHALHKELPEVTSNVFQEIEGWLQQRLGGTGSS
NMVQQASST
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggtagcgcccccgctgtcagtcctcagggggtcctgtatgcggaactgacc
cactacattaacgcagatgggcaacacattttctccagatactggaagccttcaggttct
ccccgggctctgatgtttattgtacacggtgctggggaacactgctgccgatacgatgac
ctggcacagattctaaccgctctgaactttgtggtcttttcccatgaccatgtcggccat
gggcagagtgagggggagcgaatgaccgtccctgatttccatatctttgtaagagacgtt
atacaacacttggacctcatgaagaaacaatacccgggcctgccgctttttatgtgtggc
cattctatgggaggagccattgccatcctgactgctgatgagagaccggatgacttttct
ggattaatcctaatatctcctttggtgttgcctaacccacaatctgcaacgtcattcaag
gtttttgcagctaaaatgctgaactacgtccttccaaacctttccctgggcagcattgat
ccaaatttcgtatctcgcaataagaaagaggttgaggcctatacgtcagacccactggtt
taccacggaggaatgaaggtttcctttggtgtgcagttgctaaatgctacgtctcgagtg
gagaaagctctcccgcactttaaggttccactcctgctgtttcatggaaccttggacaag
ttgtgtgatattcgtggctcccatgtgatgatggacacgatacaaagcgaggagaagaca
ctaaaggtatatgaaggagctttccatgctttgcacaaagagctgccagaggttacctct
aatgtattccaagagattgagggctggcttcagcaaagattggggggcacaggatccagc
aacatggtgcagcaagcctccagcacatag

DBGET integrated database retrieval system