KEGG   Xenopus tropicalis (western clawed frog): 100127569Help
Entry
100127569         CDS       T01011                                 

Gene name
gria1
Definition
(RefSeq) glutamate receptor 1 isoform X3
  KO
K05197  glutamate receptor 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100127569 (gria1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xtr04040]
    100127569 (gria1)
Ion channels [BR:xtr04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100127569 (gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 100127569
NCBI-ProteinID: XP_002941535
Xenbase: XB-GENE-995621
Position
3
AA seq 902 aa AA seqDB search
MLRIFAYFCTSFLGAVLGVNFPNHIQIGGLFPNQQSQEHAAFRFALSQLSEPPKLLPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYDRKTVNMLTSFCGALHVCFITPSFPVATSNQ
FVLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRLLFQDLDKSKDRQIVIDCESERLNAILTQVVKLEKNIIGYHYILANLGFMDIDM
QKFKEAGANVTGFQLVNYTDTMVSRIMQQWKNYDGREQPRVDWKKPKYTSALTYDGVRVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKGR
RTNYTLHVLELKHEGIRHIAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTILEAPYV
MLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGE
LVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIA
YGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK
GFCLIPQTTVTETVRMATLPRPSTAGGSGENGRVVSHDFPKTMQTIPCMSHGAGMALGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcatttttgcctatttctgcaccagctttctaggggcagtgcttggggtgaat
ttccccaaccatatccagataggggggcttttcccaaaccagcaatcccaggaacatgcc
gccttccgctttgctttatcccagttgtcagaaccccctaagctgctgccccagattgat
attgtgaacatcagtgatagctttgaaatgacctacactttttgttcacagttctccaaa
ggggtttatgccatatttggattttatgaccggaagacagtgaatatgttaacctccttc
tgtggtgctctacacgtctgcttcatcacccccagcttcccagtagccacttccaatcag
tttgtcctgcagctgcgaccggagctccaagatgccctcattagtgttattgaatattat
aagtggaaaaagtttgtttatatttatgatgcagaccgaggcttgtctgtcctgcagaag
gttctagacacagcagctgagaagaactggcaggtaaccgctgtaaatattctcaccacc
accgaggagggttaccgtctactctttcaggacttagacaagagcaaggaccggcagatt
gtgatcgactgcgagtccgagaggctgaatgcaatactcacccaggttgtaaagttggag
aaaaacatcattggatatcattatattcttgcaaacctgggtttcatggatattgacatg
cagaagttcaaagaagcaggagccaacgtgacaggattccagttggtcaattacacagac
acaatggtatccagaatcatgcagcagtggaagaattatgatggacgggaacaacctcgt
gtggactggaagaaaccaaagtacacctctgccttgacgtacgatggagtgagagtaatg
gctgaggcattccagagtttaaggaaacagcggatcgatatttcccgtcgtgggaatgct
ggcgactgtctagcaaatcctgcagtgccatgggggcaaggaatagacatccaaagggca
ttacaacaggttcggctggaagggctttcaggtaatgtccagtttaatgagaaaggtcgt
cggactaattatacactgcatgtgcttgagctgaaacatgaaggaatccgtcacattgct
cattggaatgaggatgataaacttatcccactggcaactgatgctcaagcaggcaatgac
accattggggtccaaaaccggacgtacattgtcactaccatcttggaggctccctatgtt
atgctgaagaaaaacgctgaccagttagaaggcaacgaccgctttgaaggctactgcgta
gagctggccgcggagatcgccaagcacgttggcttcaaatacaagctggaaatagtgaag
gacggaaagtatggagcgcgggactccgatatgaaggcttggaatggcatggtgggggag
ctggtttatgggagagctgatttggctgttgctcccttgacaataacactagtccgtgaa
gaggttatcgacttttctaaaccgttcatgagcttgggcatttcgatcatgatcaagaag
ccccagaaatctaaacctggagtattttccttcctggatcctctcgcttatgagatctgg
atgtgtatagtcttcgcctacatcggagtcagcgtggttctcttccttgtgagtcgattc
agcccatatgagtggcacaatgaggagttcgaggagggaaaagagcagccaaccactgat
cagtctaatgaatttggcatatttaacagcctgtggttttctttaggagcattcatgcag
caaggatgtgatatatccccaaggtccctctcaggacgaatcgttggtggtgtctggtgg
ttctttacattgatcattatttcatcctacacggcaaacctagcagccttcttgacagtt
gaaaggatggtctcgcctatagagagtgcggacgatttggccaagcaaactgagatagct
tatgggactcttgactccggatctactaaagagttttttaagagatcaaaaattgctgtg
tttgaaaagatgtggacttacatgcgttcggcagagccctcggttttcgtaaaaacaact
gaggaaggaatgaatcgagtgagaaaatcaaagggcaaatacgcttaccttttagagtcc
accatgaatgagtacattgaacagagaaaaccatgcgacactatgaaggtgggaggtaac
ttggactccaagggatatggcattgcaacccccaaggggtctccactgagaggtgctgta
aacctagcggtattgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaagactccggaagtaaggataagacaagtgca
ctgagtctcagtaatgtcgccggagtgttctacattctcattggaggtctgggattggcc
atgcttgttgcccttatcgagttttgttacaaatcaaggagtgaatccaaaaagatgaag
ggtttctgtttaattccacagacaacagtgacagaaacagtccggatggcaactctaccc
agaccttccacggcaggaggaagcggtgaaaatggaagagtggtcagccatgatttcccc
aaaaccatgcagacaattccgtgtatgagccacggtgcaggaatggctctgggagcaact
gggttatag

DBGET integrated database retrieval system