KEGG   Xenopus tropicalis (western clawed frog): 100127777
Entry
100127777         CDS       T01011                                 

Gene name
bola2
Definition
(RefSeq) bolA family member 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: BolA
Other DBs
NCBI-GeneID: 100127777
NCBI-ProteinID: NP_001165331
Xenbase: XB-GENE-970486
UniProt: A9JSR3
AA seq 90 aa
MAEGAALSAESLREKLTRELQAEHVEVQDTSPNHCSTSFKVLVVSPLFEGKALLQRHRLV
NGCLAEELRAIHAFEQKTLTPAQWAQEKQK
NT seq 273 nt   +upstreamnt  +downstreamnt
atggcggagggcgcagcgctgagcgccgagagtttgcgggagaaactgacgcgggagctg
caggccgagcatgtggaagtgcaggacacgtcgcccaatcactgctctacaagtttcaag
gtgctggtggtgtcgccgctgtttgaggggaaggcgctgctgcagagacacaggctggtg
aatggctgcctggcagaggagctaagggcaattcacgcctttgaacagaagaccctgacg
ccggcacagtgggcacaagagaaacagaaatga

DBGET integrated database retrieval system