KEGG   Xenopus tropicalis (western clawed frog): 100127815
Entry
100127815         CDS       T01011                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00100  Steroid biosynthesis
xtr01100  Metabolic pathways
Module
xtr_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100127815 (tm7sf2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100127815 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT Steroid_dh
Other DBs
NCBI-GeneID: 100127815
NCBI-ProteinID: NP_001106597
Xenbase: XB-GENE-1005373
UniProt: A9JTP7
Position
4
AA seq 420 aa
MADKIKTSRTSELEFGGPLGALLLLFVMPGTVLYLLVTCSTEDASVLRVPGPWPALDTLW
DPFAVILLLSWVSLQAVLYMLPIGKVTEGITLRDNTRLKYRINALQAMMVTALIAAGAVM
FGFPLSYVYDHFLQMAVGAAFIALILSIFLYAKSLAAPQSALAPGGNSGNPLYDFFIGHE
LNPRIGSFDLKYFCELRPGLIGWCLINLCFLMKDIELRGSPSLSMILVFGFQALYVVDAM
KHEEAILTTMDIVHDGFGFMLAFGDLCWVPFTYSLQGYFLVRHPQELSTYAAVGIILLNA
VGYIIFRGSNSQKNAFRRNPADPKVVGLETIPTATGKRLLVSGWWGLVRHPNYLGDLIMA
LAWSLPCGLSNILPYFYVIYFTVLLVHREARDEHQCMKKYGVAWQEYCRRVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcagacaagattaaaacatcacgtactagtgaactggagttcggtggaccactggga
gcccttctcttactctttgttatgcctggaactgtcttgtatcttctggtgacgtgtagc
acagaagatgccagtgtactgcgtgtaccaggcccttggcccgctttggacactttgtgg
gacccttttgcagtgatcttgctgctttcctgggtatctctgcaggctgtgctgtatatg
ctgcctattggaaaggtaacagaaggaattactttaagagacaacacccgtctgaagtac
agaatcaatgcattacaagccatgatggtgactgcgctcatagctgcaggagcagtgatg
tttgggttcccgctctcctatgtttatgaccatttcctgcagatggcagtgggagcagca
tttatagctctaattctcagcatttttctttatgccaagtcccttgcagcccctcaatca
gcactggcaccaggcgggaattcaggtaacccactgtatgatttcttcattggacatgaa
ttaaaccccaggattggctcctttgatttgaaatatttctgtgagcttcgccctggactc
attggctggtgcctaataaacctttgcttcctgatgaaggacattgagcttcgtggctcc
ccatctctctctatgatcttggtgtttggattccaggctttgtatgttgtagatgccatg
aagcatgaggaagccatcctcactacaatggacattgtccacgatggatttggtttcatg
ttggcttttggtgacctgtgctgggttcctttcacctactctctgcaaggatatttccta
gtcaggcaccctcaggaactgagcacttatgctgctgttggcatcatcctactaaacgct
gtgggatatatcattttccgaggctctaactcacagaagaatgccttccgaagaaatcct
gccgaccccaaagtagttgggcttgaaactatccctacagcaaccggaaaacgtcttctt
gtgtctggttggtggggccttgttcgtcatccaaattacttaggagatttaattatggct
ctggcatggtctctaccctgtggactctcaaacatcctgccatacttctatgtcatctat
ttcactgtccttctggtgcaccgggaggcgagggatgaacaccagtgtatgaagaagtat
ggagtcgcctggcaagaatattgcagaagggttccctacagaatttttccttatatttac
tga

DBGET integrated database retrieval system