KEGG   Xenopus tropicalis (western clawed frog): 100144709
Entry
100144709         CDS       T01011                                 

Gene name
akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04140  Autophagy - animal
xtr04150  mTOR signaling pathway
xtr04210  Apoptosis
xtr04218  Cellular senescence
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04370  VEGF signaling pathway
xtr04371  Apelin signaling pathway
xtr04510  Focal adhesion
xtr04620  Toll-like receptor signaling pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04910  Insulin signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04920  Adipocytokine signaling pathway
xtr05132  Salmonella infection
xtr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100144709 (akt2)
   04012 ErbB signaling pathway
    100144709 (akt2)
   04370 VEGF signaling pathway
    100144709 (akt2)
   04371 Apelin signaling pathway
    100144709 (akt2)
   04068 FoxO signaling pathway
    100144709 (akt2)
   04150 mTOR signaling pathway
    100144709 (akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100144709 (akt2)
  09143 Cell growth and death
   04210 Apoptosis
    100144709 (akt2)
   04218 Cellular senescence
    100144709 (akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100144709 (akt2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100144709 (akt2)
   04625 C-type lectin receptor signaling pathway
    100144709 (akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100144709 (akt2)
   04920 Adipocytokine signaling pathway
    100144709 (akt2)
   04914 Progesterone-mediated oocyte maturation
    100144709 (akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100144709 (akt2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100144709 (akt2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100144709 (akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100144709 (akt2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100144709 (akt2)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100144709 (akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 100144709
NCBI-ProteinID: NP_001116936
Xenbase: XB-GENE-484168
UniProt: F7EDW3
Position
8
AA seq 485 aa
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPESTEHSSIPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVAEDEE
EEAMEVKYGSPSDVSSAEQMDVAMSKGRPKVTMNDFDYLKLLGKGTFGKVILVREKSSGR
YYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGGE
LFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFGL
CKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHE
RLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAQEVMSHRFFASINWQD
VTERKLTPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESDQRPHFPQFSYS
ASIRE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcagaaaagaggggagtatatcaaa
acatggagaccacgatatttccttctaaaaagtgatggttcatttattggctataaggaa
aagccagagtccacagagcacagttcgattccgcccctcaataacttctcagttgcagaa
tgtcagctaatgaagacagagcgtcctaggcccaacacatttgtaattcgctgcctacaa
tggactacagttattgaacggacttttcatgttgacacaccagaggaaagggaagaatgg
attattgccatccagacagtggccaatggcctgaagaaccaggtggccgaagatgaggag
gaggaagccatggaagttaagtatggctcccccagtgatgtctcaagcgcagagcagatg
gatgttgcaatgtccaaagggcgccccaaagtgaccatgaatgattttgactacctcaaa
ttgctgggaaaagggacctttggaaaggttattcttgtccgagagaaatctagtggacgt
tactacgctatgaagatccttcgaaaagaggtcataatcgctaaggatgaagttgctcat
acacttacagaaagcagagttttgcagaacacaaaacacccctttttgacggcattaaag
tatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtggagag
ctttttttccacctttcacgagaacgagtttttaccgaggacagagcacgcttttatgga
gcagagattgtgtctgctttagaatatctacattctcgaaatgtggtatacagagacatc
aagctggagaatctcatgctggataaggatggtcatgtcaaaattacagattttggtttg
tgtaaggaaggcatcacagatggagctaccatgaggactttctgtggcacaccagagtac
cttgcccctgaggtgcttgaagataatgactatggccgagctgtggactggtggggtctt
ggagttgtgatgtatgaaatgatgtgtggccgattgcccttttataaccaagaccatgag
aggttatttgaacttatccttatggaggagatccgctttccccgtacattaagcccagag
gccaagtctctgcttgctgggctcttgaaaaaggatcctaagcaaagattaggtgggggc
ccaaatgatgcccaggaggtcatgtcacatcgattctttgcttctatcaattggcaagat
gtaacagaaagaaagcttactcctcctttcaagccacaagtcacatcagagattgacaca
agatattttgatgatgaatttacagctcagtctataactttgacgcctcctgacagatat
gataacctcgatgccttagagtcagatcagcgccctcactttcctcaattctcatattct
gcaagcatacgggaataa

DBGET integrated database retrieval system