KEGG   Xenopus tropicalis (western clawed frog): 100144716Help
Entry
100144716         CDS       T01011                                 

Gene name
pten, bzs, mham, mmac1, pten1, tep1
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00562  Inositol phosphate metabolism
xtr01100  Metabolic pathways
xtr04068  FoxO signaling pathway
xtr04070  Phosphatidylinositol signaling system
xtr04115  p53 signaling pathway
xtr04140  Autophagy - animal
xtr04150  mTOR signaling pathway
xtr04218  Cellular senescence
xtr04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100144716 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100144716 (pten)
   04070 Phosphatidylinositol signaling system
    100144716 (pten)
   04150 mTOR signaling pathway
    100144716 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100144716 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100144716 (pten)
   04218 Cellular senescence
    100144716 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100144716 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    100144716 (pten)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100144716 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     100144716 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100144716 (pten)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100144716 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 100144716
NCBI-ProteinID: NP_001116943
Xenbase: XB-GENE-491433
UniProt: B1H2U0
Position
7
AA seq 402 aa AA seqDB search
MTAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTNKFSCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSENENVAA
IHCKAGKGRTGVMICAYLLHRGKFPRAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYL
LKNNLEYRPVPLLFHKIEFETIPMFSGSTCNPQFVVYQLKVKIFTSTAGPKRIEKLMYFD
FPQPLPVCGDIKVEFFHKQNKVMKKEKMFHFWINTFFIPGPEEYSEKVENGTLVGEQELD
GIYSTERSDNDKEYLTLTLTKNDLDKANKDKANRLFSPNFKVKLFFTKTVEESSNSEASS
STSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQITQITKV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccattatcaaggagttcgtcagtaggaacaagaggcggtaccaggaggatgga
ttcgacttggacctgacctatatttatccaaacatcattgccatgggctttcctgcagag
aggcttgaaggtgtatacagaaataacatagatgatgtagtgaggtttctggattcaaag
cataaaaatcattacaagatctacaacttatgtgcggagagacattatgataccaacaaa
tttagctgcagagttgcacagtatccgtttgaagaccacaacccaccacagctagagcta
atcaaacctttctgtgaagatcttgaccagtggttaagtgaaaatgagaacgtagcagct
atacattgtaaagccggcaagggccggacgggggttatgatttgtgcctatttgctacac
agaggcaaatttcctagagcacaagaagccctagatttttatggagaagtgcggaccaga
gataaaaagggagttacaattcccagccaaaggcgctatgtatattactatagctacttg
ttaaaaaataacctggaatacagaccggtgcccctgctctttcacaagattgaatttgaa
actattccaatgttcagtggctcaacatgcaatccccagtttgtcgtttaccagctgaaa
gtcaagatcttcacctcaacagcaggtcccaagcgcatcgagaagttgatgtattttgat
ttcccccagcctttgcccgtttgcggggatatcaaggtagaatttttccacaaacagaac
aaagtgatgaaaaaggaaaagatgttccatttttggataaacacattcttcataccagga
ccggaagagtattcagaaaaagtagaaaatggaacgttagtcggggagcaggagcttgat
ggcatatacagtacagaacgttcagataatgacaaggaatatctcaccctcactttaact
aaaaacgacctagataaagctaacaaagacaaagccaacagattattctctccaaacttc
aaagtgaagctatttttcaccaagacagtagaagaatcttcaaactcggaagctagcagc
tcaacctctgtaacgccggatgttagtgacaatgaacctgatcattatcgatattctgac
accactgactctgatccagagaatgaaccttttgatgaagatcagatcacacaaattaca
aaagtctga

DBGET integrated database retrieval system