KEGG   Xenopus tropicalis (western clawed frog): 100144957Help
Entry
100144957         CDS       T01011                                 

Gene name
sdhb, Ip
Definition
(RefSeq) succinate dehydrogenase complex subunit B, iron sulfur (Ip)
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00020  Citrate cycle (TCA cycle)
xtr00190  Oxidative phosphorylation
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
Module
xtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xtr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100144957 (sdhb)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100144957 (sdhb)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100144957 (sdhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100144957
NCBI-ProteinID: NP_001120000
Xenbase: XB-GENE-970193
UniProt: B0BM36
Position
Un
AA seq 284 aa AA seqDB search
MAAVVFSLRRSGPVFRLPGVLQVCRGAQTAAAAAPASQAEARIKKFAIYRWDPDKPGDKP
RMQTYEVDLNECGSMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACTVR
IDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKEQYLQSIED
RDKLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWMIDSRDDYTEERLAKLQD
PFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKERAASV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcgtgttctccttgagacgtagcgggccggtgttccggttaccgggagtc
ctgcaggtttgtcgtggggcacagacagctgccgccgctgcccccgcctcccaggcagag
gctcgcatcaagaaatttgccatctacagatgggaccccgacaagcccggcgacaagccc
cgtatgcagacttatgaggtcgacttgaatgagtgtggctccatggtgctggacgcgctg
atcaagattaagaatgagatggaccccaccctgaccttccgcagatcctgccgagagggt
atatgtggctcctgcgccatgaacattaacgggggtaacaccctggcctgcaccgtgagg
atagacaccaacctgagcaaagtctccaaaatctaccccctccctcacatgtatgttgta
aaggatcttgtgcctgatctgagtaatttctatgcgcagtacaagtccatagagccgtac
ctgaagaagaaggacgagtcgcaggagggcaaggagcagtacctgcagtctatagaggac
cgggataagctggacgggctatacgagtgcattctgtgcgcctgttgcagtaccagctgc
cccagttactggtggaacgcagataaatatctgggcccggccgtgctaatgcaggcctat
cggtggatgatcgactccagagacgactacacggaggagcggctggccaaactgcaggac
cccttctccctgtaccgctgccacaccatcatgaactgcacgcgcacatgccccaagggg
ctgaacccgggcaaagccatcgccgagataaagaagatgatggcgacgtacaaggagaga
gcggcgtcggtgtag

DBGET integrated database retrieval system