KEGG   Xenopus tropicalis (tropical clawed frog): 100145087
Entry
100145087         CDS       T01011                                 
Symbol
shpk
Name
(RefSeq) sedoheptulokinase
  KO
K11214  sedoheptulokinase [EC:2.7.1.14]
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr01100  Metabolic pathways
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.14  sedoheptulokinase
     100145087 (shpk)
SSDB
Motif
Pfam: FGGY_N BcrAD_BadFG Raco_middle
Other DBs
NCBI-GeneID: 100145087
NCBI-ProteinID: NP_001120078
Xenbase: XB-GENE-991309
UniProt: B0BMP8
Position
2:complement(30623834..30637562)
AA seq 467 aa
MEADGSRLVLGIDVGTSSVKAVLLDVRSGDVVGSQSRDTRAAVQSECGPQGKEQDVIQIM
RALNDCVTSLPRESLKKVTRIGVSGQMHGVIFWKKNQGCHWINSGNLRVFEPRDTSYLIT
WEDGRCNTDFLASLPQPQSHLSLATGFGCATIFWYLRNRPDFLDSYDAAGTIQDYVVAML
CGLQRPQMSVHNATSWGYFSTRSKTWNIDILRGSGFPVHLLPAVVNAGCVAGKTSYEWCG
ICQGTEVGIALGDFQCSVYSSATESTDAVLNISTSAQLTFSMPDGFQPEESPNPGEPVAY
FPYFNDHYLAVAASLNGGNVLASFITLLSDWIAELGLAIPSSASLYTRVIAAGLSQHETH
LTIDPTLFGERHTPDRLASVSNITAAELSLGHATRALCHGIVQNLHSMLPSSRLQESGVR
RIIGSGSALSRNDVLRQEVEKIFPFPVLYGKDTDSALGAAMVMVKQW
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggaggctgacggctcccgcttggtgctggggattgatgtaggcaccagttctgtaaaa
gccgtgctgctagatgtgcgctccggggatgtagttggtagccagagccgggacacccgg
gctgcagtgcagagtgagtgcggcccacaggggaaagaacaggatgtcatccagataatg
agagccctaaatgattgtgtgacttcactacccagggaaagtcttaaaaaagttacacgc
attggagtatctggacaaatgcatggagtcatattctggaaaaaaaaccaaggctgtcac
tggataaacagcggtaatctgcgagtgtttgaaccgagagacaccagttaccttattacc
tgggaagatggacgatgcaatacagactttttggcttcattacctcaaccacaatcccat
ctctctctggcaacaggctttggctgtgcaactatattctggtatttgaggaacaggcca
gatttccttgattcatatgatgctgctggcaccattcaagactatgtggttgctatgtta
tgtggcctacagagacctcagatgtcggttcacaatgccaccagctggggctattttagc
accagatctaaaacatggaatattgacatattgcgtggatctggatttccggtgcatcta
cttcctgcagttgttaatgctgggtgtgtggcaggaaaaacatcgtatgagtggtgtggc
atttgccaggggacagaggtgggaattgctctgggagactttcagtgttctgtatattca
tctgccacagagagtacagatgcagtcctcaacataagcacctctgcccagctgaccttc
tccatgccagatggtttccagcctgaagagagccccaaccctggagaacctgtggcttat
ttcccatactttaatgaccattacttggctgttgctgcatcattgaatggagggaatgtt
cttgcatcattcatcacattgctatcagactggattgctgaattaggacttgctattcct
tcttctgcctcattgtatacccgggtgattgccgctggtttgtctcagcatgaaacccat
cttacaattgaccctacattgtttggtgagagacatacacctgataggctggcatctgta
tcaaacattacagcggcagagctttcattgggccacgcgactagggcactctgccatggc
atagttcagaacctgcattccatgttaccctccagtagacttcaggaatctggcgttagg
aggattattggaagtggcagtgcattgtcccggaatgatgtgttaaggcaggaagtggaa
aaaatcttcccatttcctgttctatatggaaaagatacggattcagctttaggtgctgct
atggtaatggtaaagcagtggtga

DBGET integrated database retrieval system