KEGG   Xenopus tropicalis (western clawed frog): 100145317
Entry
100145317         CDS       T01011                                 

Gene name
upb1
Definition
(RefSeq) beta-ureidopropionase
  KO
K01431  beta-ureidopropionase [EC:3.5.1.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00240  Pyrimidine metabolism
xtr00410  beta-Alanine metabolism
xtr00770  Pantothenate and CoA biosynthesis
xtr00983  Drug metabolism - other enzymes
xtr01100  Metabolic pathways
Module
xtr_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100145317 (upb1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100145317 (upb1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    100145317 (upb1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100145317 (upb1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     100145317 (upb1)
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-GeneID: 100145317
NCBI-ProteinID: NP_001120264
Xenbase: XB-GENE-976127
UniProt: B1H183
Position
1
AA seq 383 aa
MAGELESLEKLLEKHIPSDDLKEVWRLLYGKQIRPLNLPNSASQAASKEGFDLQGYLFEA
AQEQTRRPRTVRVGLIQNKIQLPTTEPVTEQISALHRRIAEIVEVAATCGVNIVCFQEAW
SMPFAFCTREKLPWTEFAESAEDGMTTKFCQELAKKHNMVIVSPILERDSVHGDTLWNTA
VIISNTGAVMGKSRKNHIPRVGDFNESTYYMEGNTGHRVFQTAFGKIAVNICYGRHHPLN
WFMYSMNGAEIIFNPSATIGELSESLWPIEARNAAIANHCFTCSINRVGTEHFENEFTSG
DGKKAHHDFGHFYGSSYVSAPDGSRSPGLSRVRDGLLVAEMDLNLCRQTSDKWNFKMTGR
YEMYAEELTKATQPDFKPNIIRE
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcgggggagttggaatctttagagaaactgctggaaaagcacatcccatccgatgac
ctgaaagaggtgtggaggctgctgtatgggaagcagatacggcccctgaacctccccaac
agtgcctctcaggctgcctctaaagaagggtttgacctgcagggatatttgtttgaagca
gcccaagagcagacaagacgacctcggacagtacgagtgggattaatccagaataaaatt
caactcccaactacagaacctgttacagaacagatctctgctctccacagacgcattgct
gaaatagttgaggttgcagccacgtgtggtgtgaatatagtctgtttccaagaagcttgg
tccatgccctttgctttctgtacaagagagaagcttccttggacagagtttgctgaatct
gctgaggatggaatgaccaccaaattttgccaggagctcgccaagaagcacaatatggtc
attgtgtctccaattctggaaagggactcagtgcacggagacacactttggaacacagct
gtgatcatatcaaatacaggagctgttatggggaagagccgaaagaatcacattccaagg
gtgggagattttaatgagtccacttactacatggagggaaacacaggacaccgcgtattt
cagacagcatttggcaagattgcagtgaatatctgctatggcaggcaccatcctctcaat
tggttcatgtacagcatgaatggagcagagattattttcaatccttcagccaccattgga
gagcttagtgagtccctgtggcctatagaagctagaaatgctgcaatcgccaatcactgt
tttacttgttccatcaaccgtgttggaacagagcattttgaaaatgagttcacatctgga
gatggcaagaaagcacatcatgattttggccatttctatggctctagctatgtatctgcc
ccagatgggagtcggtctcctgggctcagccgagtaagagatgggctgctggtggctgag
atggatttaaatctgtgccgacagactagtgataaatggaacttcaagatgactggacgc
tatgagatgtatgctgaagagctgactaaagccacacagccagacttcaagcctaatatt
atacgagagtaa

DBGET integrated database retrieval system