KEGG   Xenopus tropicalis (western clawed frog): 100145708
Entry
100145708         CDS       T01011                                 

Gene name
ptger4
Definition
(RefSeq) prostaglandin E2 receptor EP4 subtype
  KO
K04261  prostaglandin E receptor 4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100145708 (ptger4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100145708 (ptger4)
G protein-coupled receptors [BR:xtr04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    100145708 (ptger4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100145708
NCBI-ProteinID: NP_001120554
Xenbase: XB-GENE-992300
UniProt: B1WAT2
Position
1
AA seq 471 aa
MSYEQNFSVPNATSIQNLVAPRGSTPPIIPAVMFLLGVVGNLIAIIVLCKSRKEQKETTF
YTLVCGLALTDLLGTCLISPVTIATYIQGEWPGGHALCEYGSFILLFFGLAGLSIICAMS
IERYLAINHAYFYNHYVDKKLAGLTLFAIYVSNVLFCALPSMGLGKTTFQYPKTWCFIDW
RTNVSTYAAYSYMYAGFSSFLILATVLCNVLVCVALIRMHRQFVRRTSLGTDNRLSDFRR
RRSFRRMAGAEIQMVIVLIGTSVVVVICSTPLVVRIFINQLYQPAVVEDISKNPDLQAIR
MASVNPILDPWIYILLRKTVLSKLIEKIKCLFCRIGARRRPHSAGSFNCTEGRRASSALS
SHSPSFISRELREVSSTSQTLLYPLELSDGSLKGSAVLPGTTIAINLPGSTDRTLRGSDQ
SVSSQGPESEQVSLVNETKPTRVTQNGSLSKGNPLRVTFPNETLHLSGKSI
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtcctatgagcagaacttcagtgtccccaatgccaccagtatccaaaaccttgtggct
ccgaggggcagcactccccccatcatcccagctgtcatgttcctattaggggtggtgggg
aacctcattgccatcattgtcctgtgcaagtccaggaaggaacagaaggagaccaccttc
tacaccctggtgtgtggtttggctctcaccgacctgctggggacctgcctgataagccca
gtgactatagccacctacatacagggggaatggccggggggacatgccctgtgtgagtac
ggctctttcatccttctgttctttgggctggctggtctgagcatcatctgcgccatgtcc
atcgagaggtacctggccattaaccatgcctatttctacaaccactatgtggataagaag
ttggcagggctcacactctttgcgatctacgtctccaatgtgctgttttgcgccctgccc
agcatgggactggggaagaccacctttcagtaccccaagacgtggtgtttcattgactgg
agaaccaacgtttcgacctacgcggcttactcttacatgtacgcgggtttcagctcgttc
ctcatcctggccacggtgctgtgcaatgtgctggtttgcgtggcgctaatccgtatgcac
aggcagtttgtgcgccgcacttccctggggacggacaataggctgtcggacttcaggagg
cgcagaagcttcaggaggatggccggggccgagatccagatggtcattgtgctcatcgga
acatcagtggtggtggtgatctgctctacccccctagtggttcgtattttcattaatcag
ctctaccagccggcggtggttgaggatatctcaaagaatccagatctgcaggccatccga
atggcatcggttaatcctattctggatccttggatttacatcctcctcaggaagactgtc
ttgagcaaactgatagagaaaatcaagtgtttattctgtcggattggtgcgcgcaggagg
ccacactccgcaggaagtttcaactgcacagaaggaagaagggcctcctccgctctctcc
agtcattctccttcattcatttctcgggagcttagagaagtcagttcgacttctcagact
ttactctatcccctagaactgagtgatggtagtttgaaagggagcgctgtgttgccagga
accacaatagccattaacctgcctggatcaacagataggacgttgcggggttctgatcag
tccgtttcttctcagggtccagagtcagagcaagtgtcacttgtgaatgagacaaaaccc
acacgagtaactcaaaatggttctttgtcaaagggaaacccactccgagtcacatttcct
aacgaaacattacatttatcaggaaaatccatataa

DBGET integrated database retrieval system