KEGG   Xenopus tropicalis (western clawed frog): 100170183Help
Entry
100170183         CDS       T01011                                 

Gene name
agtr1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04020  Calcium signaling pathway
xtr04080  Neuroactive ligand-receptor interaction
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04371  Apelin signaling pathway
xtr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100170183 (agtr1)
   04020 Calcium signaling pathway
    100170183 (agtr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100170183 (agtr1)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100170183 (agtr1)
   04270 Vascular smooth muscle contraction
    100170183 (agtr1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100170183 (agtr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100170183 (agtr1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100170183 (agtr1)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100170183 (agtr1)
G protein-coupled receptors [BR:xtr04030]
 Rhodopsin family
  Peptide
   Angiotensin
    100170183 (agtr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100170183
NCBI-ProteinID: NP_001123399
Xenbase: XB-GENE-478953
UniProt: B3DLC0
Position
5
AA seq 355 aa AA seqDB search
MLSNVSTGEVKCARSGMHNYIFITIPIIYSTIFVVGVFGNSLVVIVIYSYMKMKTVASIF
LMNLALSDLCFVITLPLWAAYTAMHYHWPFGDFLCKLASTAITLNLYTTVFLLTCLSIDR
YTAIVHPMKSRIRRTVMVARLTCVGIWVVAFLASLPSIIYRQIYIFPGTNQTVCALVYQS
GQIYFTIGMSLVKNIVGFFIPFLIILTSYTLIGKTLKEVCRAQRARNDDIFKMIVAVVLL
FFFCWIPHQVFTFLDVLIQMDVIQNCKIYDIVDTGMPITICIAYFNSCLNPFLYGFFGKN
FRKHFLQLIKYLPPKMRSHASVSTKMSTASQRLSDTKYASNKISLQMTDKEEHCK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaacgtatctacaggagaagtgaaatgtgccaggtccggaatgcacaattac
attttcatcaccattcctattatttatagtacaatatttgttgtaggagtatttggcaac
agcctagtggtaattgtaatttattcctacatgaagatgaagacagtggccagcatattt
ttaatgaatttagctctgtctgatttatgttttgttatcactttacccttatgggcagct
tacacagcaatgcactatcactggccatttggtgacttcttgtgcaagttggcatcaact
gcaataaccttaaatctatataccaccgtcttcttgcttacatgcctcagcattgaccgc
tacactgccattgtccatccaatgaagtctcgtattcggcgtactgtaatggttgccagg
ctgacatgtgttggtatatgggttgtagcctttttggcaagcctgcctagcataatatat
cgtcaaatatatatttttcctggtacaaatcaaacagtgtgcgccctggtatatcagtcc
ggacaaatatatttcacaatcggcatgagtttagtcaagaacattgttggcttttttatc
ccttttttgatcattttgacaagctacacattaattgggaagactctgaaagaagtctgc
agagctcaaagggccaggaatgatgatatttttaagatgattgtagcagttgttctactg
ttctttttctgttggattcctcaccaggtgtttacttttctggatgttttaattcagatg
gatgtcatacaaaactgcaaaatatacgatattgtggacacaggcatgcccattacaata
tgcatcgcttactttaacagctgtttaaacccctttctgtatggattttttggaaagaac
ttccggaaacattttctgcaactcatcaaatacttaccgccaaaaatgaggtcccacgca
agtgttagcaccaaaatgagtacagcttcacaacgcctgtcagacaccaagtatgcgtcc
aataaaattagcttgcagatgactgacaaagaggaacattgcaaatag

DBGET integrated database retrieval system