KEGG   Xenopus tropicalis (tropical clawed frog): 100216077
Entry
100216077         CDS       T01011                                 
Symbol
slc9a3r2
Name
(RefSeq) Na(+)/H(+) exchange regulatory cofactor NHE-RF2
  KO
K13358  sodium/hydrogen exchange regulatory cofactor NHE-RF2
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100216077 (slc9a3r2)
Transporters [BR:xtr02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100216077 (slc9a3r2)
SSDB
Motif
Pfam: PDZ PDZ_6 EBP50_C Peptidase_M50 PDZ_2 GRASP55_65 Tricorn_PDZ DUF6288 sCache_like
Other DBs
NCBI-GeneID: 100216077
NCBI-ProteinID: NP_001135534
Xenbase: XB-GENE-481282
UniProt: B4F6T3
Position
9:18836456..18908938
AA seq 348 aa
MAQERHRPRLCHIKRGEQGYGFHLHGEKGKSGQYIRKVEPGSPAEAAGLKAGDRVLEVNG
DNVEKETHHQVVQRIKAIENETRLLVVDRETDEYLKKSPPGSPTESQPNSSAPSTPTPGS
NNNGEVWKTKEDTSHEDQLHNNHSTENGKQDMNGQVKERCPRLCYLKKGPSGYGFNLHSE
KSRPGQFIRSVDPGSPAAKAGLRPQDRLVEVNGQNIENMKHSEVVANIKSKDNETKLLVI
DQETDDYFKKLGIAPTEAHGKGTIPLTNGVTPTQLNGDSSTSSSHSDLQSPDKDSQAGDL
IRKDPFEESGLRLSPTAAEAKEKAKAKRANKRAPQMDWSKKHEIFSNF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcccaagagcggcaccgaccccggctgtgtcacatcaagaggggagagcagggctac
ggcttccacctgcacggcgagaagggcaagagcggccagtacatccgcaaggtggaaccc
ggctcccccgccgaggctgccggactgaaggctggagaccgggtgctggaagtcaacggg
gacaacgtggagaaagagacccatcaccaggtggttcagcgcattaaagcaatagaaaac
gaaacgcggttgctggtggtggacagagaaactgatgagtacctgaaaaaatccccaccc
ggctcacctactgaatcccaacccaactccagcgccccctcaactccgactccagggagc
aacaacaacggcgaagtatggaaaacaaaggaggacacaagccatgaagatcagctacac
aataaccacagcacggagaacgggaaacaggatatgaacgggcaagtgaaggagaggtgc
cctcgtctctgttatttgaaaaaaggccccagtggttatggctttaatctgcacagtgaa
aaatcccggccgggccagtttatcaggtctgtggacccaggatcaccggcagccaaggct
ggcctaagaccgcaggatcggctggtagaggtgaacggacagaatattgaaaacatgaag
cattcggaagtggtggccaacatcaaatccaaggacaatgaaacaaagttacttgttata
gaccaagagacggacgattacttcaagaagctcgggattgcccccactgaggctcatgga
aaaggcaccatccccttgaccaacggtgtgacccctacacagctgaatggagactcttca
acgtcttcatctcacagcgacctgcaaagcccggataaggactcacaggcaggtgacctg
atcaggaaggacccattcgaggaaagcggtctgcggctcagccctacagcagctgaagct
aaggagaaagcaaaggccaagcgagccaacaagcgcgctccacagatggactggagcaag
aagcacgagatcttcagcaacttctaa

DBGET integrated database retrieval system