KEGG   Xenopus tropicalis (western clawed frog): 100216083
Entry
100216083         CDS       T01011                                 

Gene name
epn1
Definition
(RefSeq) epsin-1
  KO
K12471  epsin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100216083 (epn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100216083 (epn1)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100216083 (epn1)
SSDB
Motif
Pfam: ENTH ANTH VHS UIM EBP50_C
Other DBs
NCBI-GeneID: 100216083
NCBI-ProteinID: NP_001135540
Xenbase: XB-GENE-1006332
UniProt: B4F6U1
Position
7
AA seq 593 aa
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQG
VNVREKAKQLVSLLKDDERLKEERAHALKTKEKLAQTSTSSSASSTLNPATEAEQAWPQS
SGEEELQLQLALAMSKEEAEQVRAKEERIRRGDDLRLQMAIEESKKEAPSKQEESSLMDL
ADVFSPPAPVAASAGPWGASAAPPADPWAGGVATSTLPAASDPWGGPPVATGASSDPWGT
GAQINSTSADPWGGTQAVTTADVKAVSDPWNPGGSTATTGIPNNDPWSSSPPVAQSVKKA
ADPWAPAASFSDPWGGSPSKPSTNGTMGELDLLAGEVPMSRSLGSKSPDTFDMTAMSGSL
SDSCKPTRKTPESFLGPNAALVDLDSLISKPALQNAKTSNPFLVTGTPNATTTNPFQPNQ
QSSLTLNQLRSSPVMTLGQPVTPAGQTPATIPFTSPMVSVSPMAPGIPIANVAPMVGMQP
MAGVPNLPIGTVAPGVPGMGLPPMMPPQQLVAQPLVPNLSTQAVTSTTNPFLL
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtctacctcctccttgcgccgacagatgaaaaacattgtccataattactctgaagca
gaaattaaagtgagagaggccacttcaaatgatccatggggtccgtccagctccttaatg
tcagagattgctgacctcacctataatgtggtggctttctcagaaatcatgagcatgata
tggaagcgactcaatgatcatggaaagaactggcgacatgtctacaaagccatgacgcta
atggagtacctaattaaaactggctctgagcgggtggcacagcagtgcaaagagaacata
tatgccatacagacccttaaagatttccaatatgtggatagagatggaaaagaccagggt
gttaatgtccgagagaaagcaaaacagttggtgtccctgctgaaagatgatgaaaggcta
aaggaagaaagagcgcatgccctgaagaccaaggagaagctggcacaaacctccacatcg
tcttctgcatcctccaccttaaacccagccacagaagcagagcaggcatggcctcaaagc
agcggagaggaagaactccagctccagcttgccttggccatgagcaaagaagaggcggag
caggtaagagcaaaggaggagaggatcagacgaggagatgacctccggcttcaaatggct
atagaggagagcaaaaaagaggcaccttccaagcaggaagagtcatcactaatggattta
gctgatgtcttcagcccccctgcaccagttgccgcttctgcaggcccatggggtgcctca
gctgctccccctgcagatccatgggcaggtggagttgccacgtctacactaccagcagcg
tctgacccatggggaggccctccagtggctacaggtgcaagctctgatccatggggaact
ggtgcacagataaactccacttctgctgacccctggggtggaacacaagcggttaccact
gccgatgtcaaagctgtgtctgatccatggaatccaggaggttccactgcaactaccgga
atcccaaacaatgatccctggtcatctagtccaccagtggctcagtctgtaaaaaaagct
gccgatccgtgggcccccgcagcttcgttttctgatccatggggtggatcaccttctaag
ccgagcacgaatgggacaatgggtgagctagatctgttggcaggagaagtccctatgtct
cgttctttaggatcaaagagccctgatacctttgacatgacagcaatgagtggctcactg
tctgactcctgcaaaccaacccggaaaacacccgagtccttcctgggacctaacgctgcc
cttgtagacttggattctctgatctctaaacctgcattacagaatgcaaagacctccaac
cctttccttgttacaggaacacccaatgcaaccacaacaaatccattccagcccaaccaa
cagtcatctcttactctgaaccagctgcgctcaagccctgtgatgacattgggacagcca
gttaccccagccggccaaacgcccgcgaccattcctttcacttcccccatggtgtctgtg
tctcctatggcccctggaattcctatagcaaatgttgcaccaatggttggaatgcagcct
atggctggagttcccaacttgccaattggtaccgtggctcctggtgtacctggtatgggt
ttgccacctatgatgccaccacagcagttggttgcacagccacttgtcccaaatttatca
acacaagctgtgacgagtactactaatccttttctgttatga

DBGET integrated database retrieval system