KEGG   Xenopus tropicalis (western clawed frog): 100216166
Entry
100216166         CDS       T01011                                 

Symbol
chmp1a
Name
(RefSeq) charged multivesicular body protein 1a
  KO
K12197  charged multivesicular body protein 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04144  Endocytosis
xtr04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100216166 (chmp1a)
  09143 Cell growth and death
   04217 Necroptosis
    100216166 (chmp1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100216166 (chmp1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100216166 (chmp1a)
Membrane trafficking [BR:xtr04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100216166 (chmp1a)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100216166 (chmp1a)
  Exosomal proteins of other body fluids (saliva and urine)
   100216166 (chmp1a)
  Exosomal proteins of colorectal cancer cells
   100216166 (chmp1a)
SSDB
Motif
Pfam: Snf7 Ist1 FliG_N GrpE
Other DBs
NCBI-GeneID: 100216166
NCBI-ProteinID: NP_001135608
Xenbase: XB-GENE-5812950
UniProt: B5DDV9
Position
4
AA seq 196 aa
MDDTLFQLKFTSKQLEKLAKKAEKDSNTEQAKVKKALQQKNVEVARVYAENAIRKKNEGL
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSSMDLQKVSAVMDKFDQQVQ
NLDVHTSVMEDSMSSAMTLTTPQEQVDNLIVQIAEENGLEVMDQLNQLPQGASSVGESST
RTPEDQLSRRLAALRN
NT seq 591 nt   +upstreamnt  +downstreamnt
atggacgatacactttttcagttgaagttcacatcgaaacagctggagaaattggcgaag
aaggcagaaaaggattccaacacagagcaagccaaagtgaaaaaggcattgcagcaaaaa
aatgttgaagttgcccgagtgtatgcagaaaatgccatcaggaaaaagaatgaaggtctg
aactggctgcgaatggcttcacgggtagatgcagttgcatccaaggtccagactgcagta
accatgaagggggtgacaaagaatatggctcaggtcaccaaggcactggacaaagctttg
agttctatggacttgcagaaagtgtcagctgtcatggataaatttgatcagcaggttcag
aacctggatgtgcacacatcggtaatggaggactccatgagttcagcaatgacactgacc
acccctcaagaacaggtagacaacctcattgtacagattgcagaggagaatgggctggag
gtgatggatcagctgaatcagctgccccaaggagcttcatcagtgggtgaaagctctacc
cgcaccccggaggaccagttgtcccgcaggttggctgctctaaggaactga

DBGET integrated database retrieval system