KEGG   Xenopus tropicalis (western clawed frog): 100216257Help
Entry
100216257         CDS       T01011                                 

Gene name
dock6, zir1
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100216257 (dock6)
Membrane trafficking [BR:xtr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100216257 (dock6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N DUF494
Motif
Other DBs
NCBI-GeneID: 100216257
NCBI-ProteinID: XP_017948180
Xenbase: XB-GENE-992620
Position
3
AA seq 1891 aa AA seqDB search
GQQDLAAGVREQLRLCFCISRTVAAEVRKQVAREYGGSPQLSKKRGGQASVPLSDVVEPL
DFEEYLSSHPPDAECEAIRDLYDVPPDDIEILYEPRECRTIEPAAPEEGKLDARVREALK
VYMHDWVLVQRRSQELSTAYSPITLERQRQLQRGLSRHLYEVDEAEEERAAQEEQEDKKR
ASVSMDDTPRGSWASSIFDLKNSSPDPLLPGLLERAPSEETDQINQEQRREGRHPQILAL
YSAPDEDEAVERSSIPEVPKEHFGFRLLVKFLSLKFEIEIEPIFGVMALYDAKEKRKISE
GFHFDLNSDSVKNMLRSQGGHQAPSTLARSAIFSITYPSPDIYLIIKLEKVLQQGDIGEC
CEPYMVLKESDGMKNKEKVDKLRGQADQFCSRLGRYRMPFAWTAIHLMNIVSSVGAVERD
SDSDSERKGTWNERKRKAFERLSVGDETCGLHTFRPATLTVTNFFKQEGDRLSDEDLYKF
LADMRRPSTALRRLRPVTAQLKIDVSPAPENPQFCLTPELRHVKPYPDPRVRPTKEVLEF
PSREVYVPHTSYRNLLFVYPRSLNLSSRQGSVRNIAVKVQFMAGEDPNQALSVIFGKSSC
SEFCSEAYTPVVYHNKSPDFYEEFKMKIPGNLTENHHLLFTFYHVSCRPNQSSAVETPAG
YTWIPLMQHGRLQTGSFSLPVSVEKLPPSYSVLTPDVSRCIFYYTSHTTLNSSVWRGSVQ
REQRQNVERSPNRISSYMEGGASSVQPRPTAKKLLHEELVLQWVVSSAAVREAAMSQAWF
FFQLMTKSMTLHLHMSERLDAPRRQRFPERFVDDISALVCNVCSEITSRYLKDPEFTERL
NSSLAFFLNDLLSLMDRGFVFNLIRSYYKQVNNKLSTAQNPNALISMRMDLIRIVCSQEH
YVSLNLPCGTLTPPNSPTPSISSTTSQSSVFSSPAQDRTITNMFELSVPFRQQHFLAGLI
LTELSLILEPDVEGVFFLQKKSISTLHNLICSHDTDPRYAEPLVKESVARLYLPLIGVIL
ENLPQLYDFTDPHAHRVRNVSALVDEVDSDGTTINPTVAMAIAGSPLPAPQKTNNFPLPP
PPARAGSTLSADASRNLLVCALWVLKNAERDLLHRWFSNLTVLQLTRLLELLSLCVSCFQ
YKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQDMVKRSRERGPFGNQENVRWRKN
ITQWRPTSEKTEKTQAERELEIIVDGNMATEANMVVLDTLEIVVQTVMMSELKESILAGV
LKVILHSLGCSQSALYLQHCLASQRALVSKFPEMLFEDDTELCSDLCLRLLRHCSSCISS
VRTQASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQKFNEEHLRRSLKTILTYA
EEDLEMRDTTFPEQVQDLVFNLHMILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLR
LTWLQNMAAKHSERGNQAEAAHCFVHGAALVAEYLSMLEDARHLPVGCVSFQNISSNILE
ESAVSDDVVSPDEEGICAGKYFTEAGLVGLLEQACASFNLGGLFEAVNEVYKILIPIYEA
SRDYKKLAVVHGKLQEVFSKITNQITSWERMFGTYFRVGFYGSKFGDLDEQEFVYKEPSI
TKLAEISHRLEEFYTERFGEGTVQVVKDSNHVDKSKLDPNKAYIQITYVEPFFDTYELKD
RVTYFDKNYNLRTFLFCTPFTLDGRAHGELHEQYKRKTVLTTSHAFPYIKTRINVLDREE
VVLIPVEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGCVGTTVNQGPLEVAQVFLSE
IPEDPRLYRLHNKLRLCFRDFTKRCEDALKKNKTLIGPDQREYHRELERNYQRLREALAP
LTSRRIPQLYNDLLPHTTARDSLNRSSRIDV
NT seq 5676 nt NT seq  +upstreamnt  +downstreamnt
gggcaacaggatttggctgccggggtcagagagcaattaaggctttgcttttgtatttcc
aggacagtggctgcagaggttcgaaagcaagtggcccgggagtatgggggctctccgcag
ctttccaagaagcgagggggtcaggcgtcggtgcccttgtctgatgtagtagaacccctg
gattttgaggagtacctctccagtcaccccccagatgctgagtgcgaggccatcagagat
ctctatgatgttcctcctgatgatattgagattctatatgagcccagagaatgtcgcact
atagagccggctgcaccagaggaggggaagttggatgcgcgagtgcgggaagcactgaag
gtttacatgcatgactgggtgctggtacagagaagatcccaggagctgagcacggcctac
tcacccatcacgttggaacgccagaggcagctccagaggggcttgagccgacacctgtat
gaagtggatgaggctgaggaagagagggctgctcaggaggagcaggaggacaagaagcgt
gcgtcagtctctatggacgataccccccgtgggagctgggcctcaagcatcttcgacttg
aagaattcctccccggaccccctgcttcccggtcttctggaaagggcaccctctgaagag
acggatcagattaaccaggagcaacgcagagaaggcaggcacccccaaatcctggccctt
tactcagctcctgatgaggatgaagccgtggaacgttccagcattccggaggtgccaaaa
gaacactttgggttccggttgctcgtgaagttcctctcactgaagtttgagatagaaatc
gagcccatatttggggttatggctctttatgatgctaaagaaaagagaaagatatcggag
ggcttccactttgacctgaactcagactccgtgaagaatatgctgaggtcacagggtggg
caccaggcaccttctacccttgcacgttctgccattttctccatcacgtacccctctcca
gacatataccttatcataaagctggagaaggtgctgcagcaaggggatataggagagtgc
tgtgagccgtatatggtgctgaaggagagcgatgggatgaagaacaaggagaaggtggac
aagctgcgaggccaagcggaccagttctgctcacgactgggccggtaccgcatgcccttt
gcttggacggccatacacctcatgaatatcgtcagcagcgtgggggcggtcgagcgagat
tccgactcagatagtgaacgaaagggaacctggaatgagcggaagaggaaagcattcgag
cggctgagcgttggagatgagacgtgtgggcttcacacctttcgcccggcgacacttact
gtcaccaacttcttcaaacaggaaggggaccggctgagcgatgaagatctctacaaattc
ctggccgatatgaggagaccttctacagctctgcgccgcctgcgcccagtaacagctcag
ctaaagattgacgtgtccccggctccggagaacccccagttctgtctgactccagagctc
cgtcatgtaaagccctatccggacccacgtgtgcgaccgactaaagaggtgctggagttt
ccatctcgagaggtgtacgtacctcacacgtcttatcggaatctgctgtttgtgtaccct
cgaagcctgaacttaagcagccgtcaggggtcggtgaggaacattgctgtgaaagttcag
ttcatggctggagaggacccaaatcaggcattgtcggtgatctttggcaaatcaagctgt
agtgagttctgcagtgaggcttacacacctgttgtgtatcacaacaagtctcctgatttc
tatgaagaattcaaaatgaaaatcccaggaaatctgacagaaaatcatcaccttctcttc
accttttaccacgtgagctgcaggcccaatcagagcagtgctgtggagactccggcaggg
tatacgtggattccactgatgcaacatggccgtctgcagactggatctttctctcttcct
gtatcggtggagaagctgcccccaagttattcggtgctgacccccgatgtgagtagatgc
attttttactatacgtcacacacaactctaaacagctcagtatggaggggatcagtacaa
cgggagcagaggcagaatgtggagcgcagccctaaccgcatatccagctacatggagggt
ggagcatcctctgtccagccgcggccaaccgccaaaaagttgctgcacgaggagttggtg
ctgcagtgggtggttagcagcgccgcggtacgggaggccgccatgagtcaagcttggttc
tttttccagctcatgacgaagagcatgacccttcacttgcacatgtctgagaggctggac
gccccccggagacagcgctttccggagagattcgttgatgatatttctgcgcttgtgtgt
aacgtttgctcagagattaccagccgctacctcaaggatccagagtttactgagcgcctg
aatagcagcctcgcctttttcctgaatgatctcttgtccctgatggaccgaggatttgtc
tttaatctaatccgatcttactacaagcaggtgaataataagttgtcaacagcacagaac
ccgaatgccttgatatctatgcgcatggatctgatccgcattgtgtgctcccaggaacac
tacgtctccttgaacttaccctgtggcactctgacacccccaaattccccaactccttcc
atctcctccaccacctcccagagctcggtgttctccagcccggcccaggacaggactatc
acaaacatgtttgaactgtcggtgccattcagacagcagcacttccttgccggcctaatc
ttgacagaactttcccttattctggagccagatgtagaaggagtattctttctccagaag
aagtccatcagcactctgcacaacctgatctgcagccacgacactgacccccgctatgca
gagccactggtcaaagagagtgtcgctcgcctctacctacccctgattggtgtcatactg
gagaatctgccccagctgtatgattttactgatccccatgcacatcgggtgcgcaacgtt
tctgcactggtggatgaggtggactcggatgggacaactatcaatccgacagttgccatg
gcaatagctggatccccgttacctgctccacagaaaaccaataactttcctttaccgcct
cctcctgcccgggcaggtagcaccctctctgctgatgctagtcgcaatctgctggtctgc
gccctgtgggtgttgaagaacgcagagagagaccttttgcaccgttggttctccaacctg
actgtgctgcagctcactcgccttctggagctgctcagcctgtgtgtctcctgtttccag
tataagggcaagaaggcctttgaacgtataaacagtctgacatttaagaagtcactggat
atgaaggcccggttagaagaagcaatactagggacgataggggcccggcaagacatggtg
aaacgcagcagagaacgtggtccctttggtaaccaagagaatgtgcgatggaggaaaaac
ataactcagtggaggccgaccagtgagaagacagagaagacacaagcagaacgagagcta
gagattatagtagatgggaatatggcgactgaggccaatatggtggtgttagacacgctg
gagatcgttgtgcagacagtgatgatgtctgagctgaaagagagcattctggcaggagtg
ctgaaagtgatattacacagcttgggctgcagccagagtgccctatacctgcagcactgt
ctggccagtcagagagcactggtgagcaagttcccagagatgctctttgaagatgatacc
gagctgtgctctgatctgtgtctccgactcctacgccactgcagcagttgtatcagcagc
gtccgcacccaggccagtgcctctctctacctactcatgaggcagaactttgagattgga
aataattttgctcgggtaaagatgcaggtcaccatgtccctctcctcattagtggggaca
tcacagaagtttaatgaggagcacttgcgccggtcactaaagaccatcctgacatacgca
gaggaagatctggagatgagagacacaacgttccctgagcaggtccaagatctggtgttc
aatctacacatgatcctgacagacacggtgaagatgaaggagcatcagcaagaccctgag
atgttaatagatttaatgtataggattgccaagggataccagaactcaccagacctgcgt
ctcacgtggctccagaacatggcagccaaacacagcgaacgtgggaatcaagcggaggct
gcccactgctttgtacatggcgccgccctggtggcggaatacctcagcatgctggaggat
gccagacacctgcctgtgggctgtgttagcttccagaatatctcctccaacattctggag
gagtcggcggtgtccgacgacgtggtatcgccagatgaggagggaatatgcgctggcaaa
tacttcaccgaagcaggactggtgggactactggagcaggcctgtgccagctttaacctg
ggcggcctgtttgaggcagtgaatgaagtgtacaagatacttatacccatctatgaagcc
agtcgagattacaagaaattggcggtggttcatgggaaattacaggaggtgttcagcaag
atcaccaaccagatcacaagctgggagaggatgtttgggacctatttccgtgttggtttc
tatggttcaaagtttggagatctggatgagcaggagtttgtctataaggaaccatccata
accaaactggcagagatatctcaccgcctagaggagttctacactgagaggtttggggaa
gggacagtgcaagtcgttaaagattccaatcatgtggataaaagcaaactggacccaaac
aaggcgtatattcagatcacgtatgtggagccatttttcgatacgtatgaactgaaggac
cgcgtcacatacttcgacaaaaactacaacctgcgcaccttcctcttctgcacacccttc
acgctggacggccgggcacacggggagctgcacgagcaatacaagcgcaagactgtgctc
actacatcccacgccttcccctacatcaagacacgcatcaatgtgcttgaccgggaggag
gtggtgctcatcccggtagaagtggcaattgaagacatgcagaagaagactcaggagctg
gcgtttgccactcaccaggacccggctgatgctaagatgctacagatggtgctgcagggc
tgcgtgggcacaacagtcaaccagggccctctggaggtggcccaggtgtttctgtctgag
atcccagaagatccgcgactttaccgactccataataagctgcgcttgtgcttccgggac
ttcaccaagaggtgtgaggatgccctgaaaaagaacaaaactctaattggtccagaccag
cgagaatatcacagggagctggagaggaactatcagaggcttagagaggctcttgcccct
ttaacgtctcggaggatcccacaactctataatgacttattgccccacactactgccaga
gactctttgaatcgctcaagtcgtattgacgtttga

DBGET integrated database retrieval system