KEGG   Xenopus tropicalis (western clawed frog): 100316929
Entry
100316929         CDS       T01011                                 

Gene name
kiss1r
Definition
(RefSeq) kiSS-1 receptor
  KO
K08374  KISS1 receptor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100316929 (kiss1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100316929 (kiss1r)
G protein-coupled receptors [BR:xtr04030]
 Rhodopsin family
  Peptide
   Galanin
    100316929 (kiss1r)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100316929
NCBI-ProteinID: NP_001163985
Xenbase: XB-GENE-990075
UniProt: F6SV79
Position
1
AA seq 366 aa
MDNESLFSFNDSCLGGMVYLCTNMSDLEKYGDPPRPPQLVDAWLVPLFFAMLMLVGLTGN
SLVIYVISKHKQMRTVTNFYIANLAATDIIFLVSCVPFTAALYPLPGWIFGEFMCKFVNY
IQQVSVQATCVTLTAMSVDRWYVTVYPLQSLRQRTPRVAAAVSVGIWIGSFIVSIPVPIY
NQLIEGYWFGPQIYCSESFPSVSHEKAFILYNFLVVYLLPLITICICYSAMVYQMGRPSV
EPVDNSYQVQLLAERSELMRTKISRMVAVIVLLFTICWGPIQLYILFQAFSPSFKRDYYT
YKVKIWANCMSYTNSSINPIVYAFMGANFRKAFNKVFPFLFKQRVGSTGVANANANTEMH
FVSSGT
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggataacgagtcattgttttcctttaatgattcctgcctggggggtatggtgtaccta
tgtaccaatatgtcagacttggaaaaatatggggaccctccacgaccacctcagctggta
gacgcatggctagtgcccctattttttgccatgctgatgttagtagggttgactggaaat
tctctggtgatttacgttatctccaagcacaagcagatgagaactgtcaccaacttctat
atagctaatctggcagcaacagacattatcttccttgtttcctgtgtgcctttcacagct
gcgctttatcccctgcctggctggatatttggggaatttatgtgcaagtttgtcaactac
atccagcaggtgtcagtacaagccacctgtgtcactcttacagccatgagtgtggatcgt
tggtatgtcaccgtgtacccactgcagtctctgcgccaaagaaccccacgtgtagctgct
gcagttagcgtgggtatctggattggttccttcattgtatctatcccagttccaatctat
aatcaacttattgaaggctactggtttggaccacagatatactgcagcgaatcattccca
tctgtatcacatgaaaaagcttttatcctctacaactttctggtggtctacttgctgcca
ttgatcacaatctgtatctgctactctgccatggtataccagatgggccgtccatctgtg
gaaccagtcgataatagctaccaggtacagctactagcagagagatctgaactgatgcgt
acaaagatatctcgtatggtggctgtaattgtcctgctgttcacaatctgttggggaccc
atccagctctacatcctgtttcaagcctttagtcccagctttaaacgggattactacacc
tacaaagtgaagatttgggccaactgcatgtcttacaccaactcatcaatcaaccctatt
gtatatgcttttatgggagccaacttccgcaaggccttcaataaggtcttccccttcctt
ttcaagcaacgagtgggaagtactggggtggctaatgccaacgcaaatacagaaatgcat
tttgtgtcctcaggcacttaa

DBGET integrated database retrieval system