KEGG   Xenopus tropicalis (western clawed frog): 100335056
Entry
100335056         CDS       T01011                                 

Gene name
t2r3
Definition
(RefSeq) bitter taste receptor 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 100335056
NCBI-ProteinID: NP_001165466
UniProt: Q2AB78
Position
5
AA seq 308 aa
MLFPIFFSIFITTMLILGLAVNASITIFILKAWSRDGKLKPNDKILTALCFIRFFLQCNF
ITEIFGMWLELIPLSEYKPRCIFYFIQLFMDFFSRWLSAWLAMLYYVKITIFKNPFFLQL
QSLIPRITGYVIFISVFISFVPGLIYSLSAKQGFCEDAKGVNVTTNTDELLAFRIIAFFF
GHSFPFMLEMLSSIYLLCTLFAHIRHTESYISNFTAPNMEAHWTVIRYIFLMNLLSMCNF
FGNFFLWSFISSFIGRAVGYFLAFSYPTFHSVVLILSNPKMKREVVNMFHCATKLWSFSK
QEPGTVTQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atgttattcccaattttcttttctattttcattaccacaatgctcattttaggtctggca
gtcaatgcctccatcaccatttttattttgaaagcctggtcgagagacggaaaactaaag
cccaatgataaaatcctaaccgccttgtgcttcatcaggttcttcttgcaatgcaacttc
attacagaaatctttggaatgtggctggaacttatccctctgtcggagtacaaaccgcgc
tgtatcttctacttcatccagctgttcatggacttcttcagccgctggctcagcgcttgg
ctggccatgctctactacgtgaagatcactatctttaaaaatcctttcttcctacagctt
cagtctctgattccccgaatcaccggatatgtgatctttatatccgtgttcatttccttt
gtaccgggactgatttattccctgagtgctaaacagggattttgtgaggatgccaaaggc
gtcaatgtgacaacaaacacggatgagttactggctttccgtatcattgcctttttcttt
ggacacagcttccccttcatgctagagatgctttcatccatatatctcctctgcaccctg
tttgcccacatcagacacaccgaatcctacatttccaacttcacggcgcccaacatggaa
gcccactggactgttattaggtacatttttctaatgaatctcttgtcaatgtgcaatttc
tttggcaacttttttctctggtccttcatctccagttttattggaagagccgttggatac
tttctagctttctcttatcctaccttccattcagttgtcctcatattgtccaacccaaag
atgaaaagagaagtagtcaacatgttccattgtgcaacaaaactctggagtttcagcaag
caagaaccagggacggttacccaatga

DBGET integrated database retrieval system