KEGG   Xenopus tropicalis (western clawed frog): 100335058
Entry
100335058         CDS       T01011                                 

Gene name
t2r5
Definition
(RefSeq) bitter taste receptor 5
  KO
K08474  taste receptor type 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100335058 (t2r5)
G protein-coupled receptors [BR:xtr04030]
 Others
  Chemoreception
   Taste
    100335058 (t2r5)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 100335058
NCBI-ProteinID: NP_001165468
UniProt: Q2AB76
Position
5
AA seq 312 aa
MSFPIPVAVCSLVPTVTGLVVNAFITLVNIRNYLREQGLKPCDKILMALCLTRFLLQWTF
LLDIIGILLQLIPFSTFAIYCIFYVVEQFLDYFSRWLAMWLSILYYVNITIFKNVLVLYL
KSRIPHVTSYMIFVSAFLSFGPGLIYSLTSSEVSCLRVSNQSLSKNATYETKEFLSISFV
FGQCLPSVIEMVSSIYLLWTLFAHVNYTKANVSSFTAPNMDAHWSAIRCILLLYFMSACN
FIGNLILYFFSNDSFGSSLSYIITFAYPTLHSVVFVLNHSKLKKELAKILYCEKSVVGFR
AETVVRSSLGQA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtcatttccgattcccgtggctgtttgttccctggttccgaccgtgacagggttggtg
gtcaatgcctttatcacccttgtaaacatccggaactatttaagggaacaggggctgaaa
ccatgtgataagattctaatggctttgtgcttgaccaggtttctcctgcaatggactttc
cttctggatatcattgggattttgctccagttgattcctttctccacattcgctatctac
tgtatcttttatgtggtggaacagtttttggactacttcagccggtggctagcgatgtgg
ctctccattctgtactacgtcaacatcacaatcttcaaaaatgtcttagtcctctatttg
aagtcaaggatcccccacgtcactagttacatgatcttcgtctcggcgttcctttccttc
ggcccgggactgatttattctttgaccagcagtgaggtctcttgcctgagggtctccaac
caaagtctttccaagaatgcaacttatgaaaccaaagaattcttgtccatctcctttgtc
ttcggacagtgtttgccttctgtgatagagatggtttcatccatttatctgctctggact
ttatttgctcatgtcaactacaccaaggccaatgtttccagcttcacggcacccaacatg
gacgcccactggtctgcaatccgatgtattcttctactgtatttcatgtctgcctgtaat
ttcattgggaacctcattttatatttcttttctaatgattcttttggaagttcccttagt
tacataataacctttgcttaccccactctgcattctgtcgtttttgtactgaaccattcg
aagctgaagaaagaactggcaaaaatattgtactgtgagaaatctgtggttggtttcaga
gcagagactgtggtaagatcatctctaggccaggcctaa

DBGET integrated database retrieval system