KEGG   Xenopus tropicalis (western clawed frog): 100335073
Entry
100335073         CDS       T01011                                 

Gene name
t2r22
Definition
(RefSeq) bitter taste receptor 22
  KO
K08474  taste receptor type 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100335073 (t2r22)
G protein-coupled receptors [BR:xtr04030]
 Others
  Chemoreception
   Taste
    100335073 (t2r22)
SSDB
Motif
Pfam: TAS2R UPF0182 7tm_1
Other DBs
NCBI-GeneID: 100335073
NCBI-ProteinID: NP_001165481
UniProt: Q2AB61
Position
9
AA seq 296 aa
MLFFINVIKITYLIVTWLCGSILNSSIVAVYLREWKNGMSLGECDRTILTMGCNNLFLQC
FLTMNEVITIFELYGLFLKEFTLVGCILYFFLCYVSMWLTAWLSICYYVKLVNFSHRLLI
RFKRTIPSASAPFLFGSVVGSCLINVPFIWTMDTEFLQNTTVSAENFLFKMDLRFMSFNV
VIGSCVPVLVTSVCMGFSVMSLLRHVQRMKNNTSQSWNPQSKSHVRACRTMSLLMIMNLI
FFLAVITVAMGLTKFNAIIARRIIYWLVVMASPSAEAIILILGNTKLKMALPKICF
NT seq 891 nt   +upstreamnt  +downstreamnt
atgttgttctttataaatgtgatcaagataacatatcttatagtaacttggctatgtggg
tccatcttaaactcatctattgtagctgtgtatctcagagagtggaagaatggaatgagc
cttggtgagtgtgatcggaccattctgaccatggggtgcaacaacctattcctacagtgc
tttttaaccatgaatgaagtcattactatttttgaactgtacgggttgtttcttaaagag
ttcactctagttggttgtatattgtacttctttttgtgctacgtctctatgtggctcact
gcctggctttccatttgctactacgtgaaactagtcaacttttcacatcgattgttaatt
aggtttaaaagaacaatcccctctgcaagtgctcctttcctcttcggatcagtggtgggt
tcatgcttgattaatgttcccttcatttggacaatggatacggaatttctgcaaaatacc
accgtatcggctgaaaactttctcttcaaaatggatcttagattcatgtctttcaacgtt
gttattggttcctgtgtgcctgtccttgtcacctctgtttgtatgggatttagtgtgatg
tcccttctgagacatgtccagaggatgaagaacaacacttctcagtcctggaatcctcag
tcgaagagccatgtccgagcttgcagaacaatgtccctcctgatgattatgaacttgatt
ttctttttggcagttattactgtggccatgggtcttacaaaattcaatgccatcattgct
agacgtataatatactggttagttgttatggcaagtccctcagccgaagccatcattctg
atccttggaaataccaagctaaaaatggccttgccaaagatctgtttttga

DBGET integrated database retrieval system